SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006744049.1.47382 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006744049.1.47382
Domain Number 1 Region: 2289-2382
Classification Level Classification E-value
Superfamily C-type lectin-like 7.53e-31
Family Link domain 0.00012
Further Details:      
 
Domain Number 2 Region: 589-727
Classification Level Classification E-value
Superfamily FAS1 domain 5.62e-30
Family FAS1 domain 0.0018
Further Details:      
 
Domain Number 3 Region: 1553-1601,1679-1793
Classification Level Classification E-value
Superfamily FAS1 domain 3.92e-29
Family FAS1 domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1793-1948
Classification Level Classification E-value
Superfamily FAS1 domain 1.07e-25
Family FAS1 domain 0.0052
Further Details:      
 
Domain Number 5 Region: 1045-1202
Classification Level Classification E-value
Superfamily FAS1 domain 5.36e-24
Family FAS1 domain 0.0032
Further Details:      
 
Domain Number 6 Region: 466-581
Classification Level Classification E-value
Superfamily FAS1 domain 3.92e-20
Family FAS1 domain 0.005
Further Details:      
 
Domain Number 7 Region: 2380-2542
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-16
Family FAS1 domain 0.0092
Further Details:      
 
Domain Number 8 Region: 1208-1334
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000706
Family FAS1 domain 0.0087
Further Details:      
 
Domain Number 9 Region: 1625-1662
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000323
Family Merozoite surface protein 1 (MSP-1) 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006744049.1.47382
Sequence length 2652
Comment PREDICTED: stabilin-1 [Leptonychotes weddellii]; AA=GCF_000349705.1; RF=representative genome; TAX=9713; STAX=9713; NAME=Leptonychotes weddellii; AL=Scaffold; RT=Major
Sequence
MAGNEINGITAALAEELFEKGEQLLGAGEVFAIGPLQLYAVTEQLHHGKPTCASGDAKTD
LGHILDFTCRLKYLKVSGTEGPFGTSNIQEQLLPFDLSIFKALHQVEVRSRRCDVKTKFV
TRIPCTMCPAIKRRMCPPGWLRELPEKISQDCRYEVQLGDSLMSMSGCSLECWKDVVEKA
CCPGYWGSQCYECPGGAETPCNGHGSCLDGINGNGTCVCQENFGGSACQECQDPNRFGPN
CQSVCSCVHGVCSHGPLGDGSCLCFAGYTGPRCDQELPVCRALNCPQNSQCSAEAPACSC
LPGHTQQGRECRAPNPCQSSPCSPLAQCSVSPTGQAQCRCPKDYHGDGTVCLPQDPCTIN
YGGCPSNSTSCQYQRPGKASCLCKPGLFSVNHNASAGCFAYCFPHSCDRSATCQVAPDGK
ISCVCKEGEVGDGRACYGHLLHEIQKAGQLGVVFLWLRVSLAMLDQGCRQILTTSGPFTV
LVPSLSSVSSRTMNASLARQLCKQHIIAGQHMLEEPGTQQTRRWWTLAGQEITVTFNRFT
KYTYKYKEHPQQTFAIHKTNYPAANGVFHLVTTLQWQPPPELPEDPKRTIGQILASTEAF
SRFETILENCGLPSILDGPGPFTVFAPSNEAVDKLRDGRLIYLFTAGLSKLQELVKYHIY
SHGQLTIEKLISKGRVLTMANQVLVVNISEEGRILLGPEGLPLRRVDVLASNGVIHMLEG
VLLPPTILPILPKHCSEEQHQIVAGSCVDCQAPNTSTCPPNSVKLDIFPKECVYTHDPTG
LNVLKKGCAQYCNQTVLKPGCCKGFFGPDCAQCPGGFSNPCYGKGNCSDGVRGNGACLCF
PNYKGIACHICSNPNKHGDRCQEDCGCVHGLCDNRPGSGGVCQQGTCALGFSGRFCNESA
GNCGPAERAQHCHPQARCISQGGVTRCVCLDGFEGDGLSCVPGNPCSHPDRGGCSENAEC
VPGARGTHHCTCHKGWSGDGRVCVAIDECELDARGGCHADALCSYVGPGQSRCTCKLGFA
GDGYECSPIDPCRAGNGGCHDLATCRAVGGGQRVCTCPSGYGGDGFSCYGDIFRELEANA
HFSVFYQWIKSAGLTLPTDSRVTALVPSESAIRRLSPEDQAFWLQPRALRQLVRAHFLQG
ALSEEELTRLGGQDVATLSPTTRWEIHNISGRVWVQNASVDVADLLATNGVLHVLSQVLL
PPRGDVLPRQGLLQQLDLVPAFRLFRELLQHHKLVPQIEAATAYTIFVPTNRSLEARGNS
SRLDADTVRHHVILGEALSVEALQRGGHRNSLLGPAHWLVFYNHSGQPEVNHVLLEGPVL
EAPGRSLFGLSGVLTVGSSRCLHSHAESLREKCVNCSRRFRCTQGFQLEITPKKSCVYRS
GSSFSRGCSYTCAKRIQVPDCCPGFFGTLCEPCPGGQGGVCSGHGQCQDRLLGSGECRCH
EGFHGTACEMCELGRYGPNCAGVCDCAHGLCQEGLQGNGSCVCNVGWQGPRCDQKVSGPQ
CPKKCDPNANCLQDSAAAPACVCAAGYSGNGSYCSEVDPCAQDHGGCSPHANCTKVAPGQ
RTCTCQDGYTGDGELCQEVNGCLIRHGGCHMHADCIPTGPQQVSCSCREGYSGDGIRTCV
LLDPCSQNNGGCSPYAVCKSMGDGQRTCTCDAAHTVGDGFTCRARVGLELLRDRHASFFS
LHLLEYKELKGDGPFTVFVPRADLMTNLSQDELARIRAHRQLVFRYHVVGCRQLSSQELL
EEGYVTTLSGNPLRIHEREGSIYLNDFARVVSSDHEAVNGVLHFIDRVLLPPDVLHWEPD
AAPVLRRNVTAAAEGFGYKIFSGLVKVAGLLPLLQDASHRPLTMLWPTDSALQALPPDRQ
TWLYHEDHRDKLAAILRGHVIRNIEALASDLPNLGPLRTMHGTPISFSCSRARPGELTVG
EEDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLKICSICGLEPPCPEGS
QEQGSPEACWRYYSKFWTSPPLQSLALRSIWARSSLWGQPQGLGRGCHRNCATTTWKPSC
CPGHYGSECRACPGGAGSPCSGHGVCVDGMSGSGQCQCHARFTGTACELCAPGAFGPQCQ
VCRCSSHGRCDEGLGGSGSCFCDEGWTGPSCEVQLELQPACAPPCAPQAVCRADGSCECG
LGYEGDGRTCTVADLCRVGHGGCSEHANCSQVGTVVTCACLPAYEGDGWSCRARDPCADG
RRGGCSEHADCLSTGPNARRCVCHAGYVGDGLQCLEEPEPPVDRCLGQPPPCHVDAVCTD
LHFQEKQAGVFHLQAPSGPSGLNFSEAEAACGAQGAVLASLPQLSAAQKLGFHLCLVGWL
ANGSAAHPVVFPAADCGGGQVGVVSLGARKNRSERWDAYCYRELDVACRCRRGFVGDGTS
VCNGKLLDVLAATANFSTFYGMLLGYANATPRGLDFLDFLDDELTYKTLFVPVNEGFLDN
MTLSGPDLELHASNTTFLSANASQDTVLPAHSGLSLVFSAAGPDNSSWAPVAPGAVVLSH
VVVWDIMAFNGIIHALARPLLAPLQPRAVVAAEAPPVVAGVGAVVAAGALLGLVAGAFYL
RARGKATGFGFSTFQAEDDAEEDFSPWQEGTSPTLVSVPNPVFGSHDAFCEPFDDSLLED
DFPDTQRILAVK
Download sequence
Identical sequences XP_006744049.1.47382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]