SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006747844.1.47382 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006747844.1.47382
Domain Number 1 Region: 491-548
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.64e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 604-660
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 435-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 379-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.71e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 547-604
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 323-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.74e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 15-74
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-22
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 8 Region: 649-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-17
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 9 Region: 271-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000753
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 211-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000545
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 11 Region: 110-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000338
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 12 Region: 169-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000239
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006747844.1.47382
Sequence length 704
Comment PREDICTED: zinc finger protein 132 [Leptonychotes weddellii]; AA=GCF_000349705.1; RF=representative genome; TAX=9713; STAX=9713; NAME=Leptonychotes weddellii; AL=Scaffold; RT=Major
Sequence
MYKPICWPPGLAVSSSQSPVTFEDVAVYFSKEEWGLLDETQRRLYHHVMLENFELMTSLG
CWHGVEDEGAHSKQNTSVEGMSQVRIPSANPSTQKADTCDMCGPFLKDILHLNEHQRTYP
EETLYTCGTCGREFWFSTNLHQHQKELSGEKPFRWDKDEDSFVENLTVHLSEKLFTCGEG
GKDALDSDDLFRHPAIDSSRKPQRSTECRETFSHSSNLEQLTKVHTTQKLFKCSNCGKAF
QKTSTLLNHLRTHSQETTFRCPTVGNSLEEKSTLVNHQKSHDRETCHVCKACGKTFTHAS
KLRKHQKFHTGVKYYECSDCWKTFNHKLTLVHHQRIHTGERPYKCSECGKAFNNRSHLTR
HEKVHTGERPFECSKCGRAFSQSSNFLRHQKVHTQVRPYECNQCGKAFSRSSALIQHWRV
HTGERPYECSECGRAFNNNSNLAQHQKVHTGERPFECSECGRDFSQSSHLLRHQKVHTGE
RPFECTECGKAFSNSSTLIQHQKVHTGQRPYECSECRKAFSRSSSLIQHWRIHTGERPYE
CSECGKAFAHSSSLIEHWRVHTRERPYECSECGKFFSQNSILIKHQKVHTGERPYECTEC
GKFFSRKSSLIYHWRVHTGERPYECSECGRAFSNNSHLVRHQRVHTQERPYECSQCGKAF
SERSTLVRHQIVHTRERTYECDHCGKIFSRLCNLAQHKRIHTRM
Download sequence
Identical sequences XP_006747844.1.47382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]