SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006757501.1.95426 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006757501.1.95426
Domain Number 1 Region: 54-835
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.33e-291
Family Motor proteins 1.95e-16
Further Details:      
 
Domain Number 2 Region: 836-961
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.8e-22
Family Myosin rod fragments 0.00031
Further Details:      
 
Domain Number 3 Region: 956-1072
Classification Level Classification E-value
Superfamily Myosin rod fragments 8.11e-21
Family Myosin rod fragments 0.001
Further Details:      
 
Domain Number 4 Region: 1241-1349
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.89e-18
Family Myosin rod fragments 0.0025
Further Details:      
 
Domain Number 5 Region: 1060-1150
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000602
Family Myosin rod fragments 0.0034
Further Details:      
 
Domain Number 6 Region: 1514-1627
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000654
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 7 Region: 1348-1451
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000068
Family Myosin rod fragments 0.0094
Further Details:      
 
Domain Number 8 Region: 1760-1860
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000494
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 
Weak hits

Sequence:  XP_006757501.1.95426
Domain Number - Region: 27-60
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.00216
Family Myosin S1 fragment, N-terminal domain 0.0013
Further Details:      
 
Domain Number - Region: 1828-1923
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00549
Family Myosin rod fragments 0.017
Further Details:      
 
Domain Number - Region: 1626-1743
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0732
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006757501.1.95426
Sequence length 1960
Comment PREDICTED: myosin-9 isoform X2 [Myotis davidii]; AA=GCF_000327345.1; RF=representative genome; TAX=225400; STAX=225400; NAME=Myotis davidii; AL=Scaffold; RT=Major
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKNGFEPASLKEEVGDEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDSAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAHVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKDERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDLFQETMEAMRIMSIPEDEQIGLLRVISGVLQLGNIVFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
SYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT
LRNTNPNFVRCIIPNHEKKSGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT
DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQV
SRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAE
ELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQ
KLQLEKVTTEAKLKKLEEDQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAK
LKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAK
KEEEVQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEE
LEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEE
LAEQLEQTKRVKANLEKAKQTLENERGELANEVKALLQGKGDSEHKRKKVEAQLQELQVK
FNDGERVRTELADKVTKLQVELDNVTGLLTQSDSKSSKLTKDFSTLESQLQDTQELLQEE
NRQKLSLSTKLKQVEDEKNSLKEQLEEEEEAKRNLEKQMTTLQAQVTDMRKKMDDGVGCL
EIAEEAKRKLQKDLEGLSQRYEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSVSNLE
KKQKKFDQLLAEEKTVSAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNK
QFHTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV
NLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSLAVAARKKLELDLK
DLEAHIDSANKNRDEAIKQLRKLQAQMKDYMRELDDTRASREEILAQAKENEKKLKSMEA
EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEE
EQGNTELVNDRLKKANLQIDQINTDLNLERSHAQKNENARQQMERQNKELKVKLQEMEGT
VKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRAEKKLKDVLLQVDDERRNAEQ
FKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNK
LRRGDLPFVVPRRMARKGTGECSDDEVDGKADGAEAKAAE
Download sequence
Identical sequences L5M9U3
XP_006757501.1.95426 XP_015415353.1.95426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]