SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006776096.1.95426 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006776096.1.95426
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-27
Family SH2 domain 0.00000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006776096.1.95426
Sequence length 127
Comment PREDICTED: SH2 domain-containing protein 1A [Myotis davidii]; AA=GCF_000327345.1; RF=representative genome; TAX=225400; STAX=225400; NAME=Myotis davidii; AL=Scaffold; RT=Major
Sequence
MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGAYCLCVLYQGYIYTYRVSQTD
TGSWSAETAPGVHKRFFRKIKNLISAFQKPDQGIVIPLQYPVEKSSARSTQGTTGRREDP
DVFLKAP
Download sequence
Identical sequences G1PR06
ENSMLUP00000013546 XP_005872771.1.60319 XP_006082194.1.53796 XP_006776096.1.95426 ENSMLUP00000013546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]