SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006779973.1.46954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006779973.1.46954
Domain Number 1 Region: 231-265,294-520
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.31e-76
Family Nuclear receptor ligand-binding domain 0.00000000298
Further Details:      
 
Domain Number 2 Region: 181-258
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.01e-25
Family Nuclear receptor 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006779973.1.46954
Sequence length 521
Comment PREDICTED: estrogen-related receptor gamma-like isoform X1 [Neolamprologus brichardi]; AA=GCF_000239395.1; RF=representative genome; TAX=32507; STAX=32507; NAME=Neolamprologus brichardi; AL=Scaffold; RT=Major
Sequence
MDSVGHPLSECFLMHSEQEMNLSKGPLVNSSSEDNSKSSYGKCGAGAWRMHQSYDPLEAN
HMRDAHALYNPRLLCRMSSKERHLESSCPSSYIKTEPSSPASLTDSLNHHSPGGSSDASG
SYSSTMNGHPNGLDSPSLYGSNAGPLGPAGGPGSKRYEDCSSTIGEDSQIKCEYMLNSMP
KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACR
FMKCLTVGMLREGVRLDRVRGGRQKYKRRIDADNSPYLNPQLALPPKKPFAFGCLADNKI
VSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVNIGWAKHIPGFSTLSLADQ
MSLLQSAWMEILILRVVYRSLPFEDKLVYAEDYIMDEDQSKLAGLLDLNNAILQLVKKYK
SMKLEKEEFVTLKAIALANSDSMHIEDVDAVQKLQDVLHEALQDYEASQHQEDPRRAGKL
LMTLPLLRQTSTKAVQHFYSIKQDGKVPMHKLFLELLEAKV
Download sequence
Identical sequences I3KKJ7
XP_006779973.1.46954 XP_013132515.2.78416 ENSONIP00000021642 ENSONIP00000021642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]