SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006787309.1.46954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006787309.1.46954
Domain Number 1 Region: 2-159
Classification Level Classification E-value
Superfamily UBC-like 6.06e-52
Family UBC-related 0.000000147
Further Details:      
 
Domain Number 2 Region: 157-198
Classification Level Classification E-value
Superfamily UBA-like 1.65e-21
Family UBA domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006787309.1.46954
Sequence length 200
Comment PREDICTED: ubiquitin-conjugating enzyme E2 K-like [Neolamprologus brichardi]; AA=GCF_000239395.1; RF=representative genome; TAX=32507; STAX=32507; NAME=Neolamprologus brichardi; AL=Scaffold; RT=Major
Sequence
MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEI
KIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAA
EPDDPQDAVVANQYKQNPEMFKQTARLWSHVYAGAPVSSPDYTRKIDKLCAMGFDKNAVI
AALSSKSWDVETATELLLSN
Download sequence
Identical sequences A0A087XX52 I3JR41
ENSONIP00000011335 XP_003452184.1.78416 XP_004564367.1.88231 XP_005741198.1.53837 XP_005928351.1.24487 XP_005928352.1.24487 XP_006787309.1.46954 XP_007551984.1.10163 XP_008276622.1.38333 XP_014836348.1.96476 XP_014836349.1.96476 XP_014887839.1.100837 XP_014887840.1.100837 XP_015252542.1.42780 XP_016526906.1.10163 XP_018551228.1.34915 XP_020457791.1.23826 XP_022061776.1.10920 ENSPFOP00000010355 ENSONIP00000011335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]