SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006801015.1.46954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006801015.1.46954
Domain Number 1 Region: 59-251
Classification Level Classification E-value
Superfamily Sec7 domain 4.84e-80
Family Sec7 domain 0.00000000964
Further Details:      
 
Domain Number 2 Region: 259-380
Classification Level Classification E-value
Superfamily PH domain-like 1.73e-34
Family Pleckstrin-homology domain (PH domain) 0.000000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006801015.1.46954
Sequence length 394
Comment PREDICTED: cytohesin-3-like [Neolamprologus brichardi]; AA=GCF_000239395.1; RF=representative genome; TAX=32507; STAX=32507; NAME=Neolamprologus brichardi; AL=Scaffold; RT=Major
Sequence
MDEDNHVPEDLSVEERDELSNIRRRKRELLDDIERLKFEIAEVMTEIEQLTCVGESKTSQ
RNKQIAMGRKKFNMDPKKGIQFLLENDLLQHTPEDIAQFLYKGEGLNKTVIGDYLGERDD
FNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCQCNPGVFQ
STDTCYVLSFAIIMLNTSLHNPNVRDKPPVERFISMNRGINEGGDLPEELLRNLYDSIKN
EPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPR
GIIPLENLSIREVDEPRKPNCFELYNPNHKGQVIKACKTEADGRVVEGNHVVYRISAPTP
EEKEEWIKSIKASISRDPFYDMLATRKRRIANKK
Download sequence
Identical sequences I3KV34
ENSONIP00000024980 XP_004562401.1.88231 XP_005448193.1.78416 XP_006801015.1.46954 ENSONIP00000024980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]