SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006805169.1.46954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006805169.1.46954
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.22e-24
Family Ubiquitin-related 0.0000331
Further Details:      
 
Domain Number 2 Region: 231-297
Classification Level Classification E-value
Superfamily XPC-binding domain 1.83e-22
Family XPC-binding domain 0.0000635
Further Details:      
 
Domain Number 3 Region: 149-204
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000151
Family UBA domain 0.0003
Further Details:      
 
Domain Number 4 Region: 314-362
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000186
Family UBA domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006805169.1.46954
Sequence length 365
Comment PREDICTED: UV excision repair protein RAD23 homolog A-like [Neolamprologus brichardi]; AA=GCF_000239395.1; RF=representative genome; TAX=32507; STAX=32507; NAME=Neolamprologus brichardi; AL=Scaffold; RT=Major
Sequence
MQITLKTLQQQTIQIEIDPEQTVKALKEKIEAERGKDNFPVSGQKLIYAGKILQDDTPIK
DYKIDEKNFVVVMVSKAKPAVAASPSVSEAPKPPVQDSGSTSTAAPTTNPTPAPAPAPAA
VPIPSGEAKEESSAVATEPQQPASSSGGSQGLDASSTLVTGAEYEAMLTEIMSMGYERER
VVAALRASFNNPHRAVEYLLTGIPSSPVQESNPPAQAPTSGTTEAPSVPEGENPLAFLRT
QPQFLHMRQAIQQNPALLPALLQQLGRENPQLLQQISQHQELFIQMLNEPVGEGGDAPEV
GEMGAAGEEGAPVNYIQVTPQEKEAIERLKALGFPEALVIQAYFACEKNENLAANFLLNQ
GLEDD
Download sequence
Identical sequences XP_004570397.1.88231 XP_005750044.1.53837 XP_005941857.1.24487 XP_006805169.1.46954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]