SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006810084.1.46954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006810084.1.46954
Domain Number 1 Region: 128-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000126
Family Laminin-type module 0.0033
Further Details:      
 
Domain Number 2 Region: 80-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000162
Family Laminin-type module 0.079
Further Details:      
 
Domain Number 3 Region: 21-69
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000963
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 4 Region: 182-216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family Laminin-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006810084.1.46954
Sequence length 227
Comment PREDICTED: laminin subunit alpha-5-like, partial [Neolamprologus brichardi]; AA=GCF_000239395.1; RF=representative genome; TAX=32507; STAX=32507; NAME=Neolamprologus brichardi; AL=Scaffold; RT=Major
Sequence
KCAPGYYRDTIGLFLGKCVPCSCNGHSDQCLDGSGICVNCRHNTAGDHCETCQGGFLGNN
SVDGQAVTCSSCPCPLRAPSNNFAEGCVQRGDSMQCRCMPGYAGPNCERCAPGFYGNPVV
LGSRCQTCDCSGNSDPNMLFTDCHPLTGHCLSCMHNTAGPRCESCAPGYYGDAINAKNCT
QCDCSPCGTESCDPRGGRCRCKPGVTGPLCDRCEVRALSEVTTTSVI
Download sequence
Identical sequences XP_006810084.1.46954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]