SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006817917.1.86028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006817917.1.86028
Domain Number 1 Region: 151-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000138
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 2 Region: 116-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000625
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 3 Region: 73-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000685
Family EGF-type module 0.02
Further Details:      
 
Domain Number 4 Region: 32-70
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000949
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006817917.1.86028
Sequence length 219
Comment PREDICTED: delta-like protein C-like [Saccoglossus kowalevskii]; AA=GCF_000003605.2; RF=representative genome; TAX=10224; STAX=10224; NAME=Saccoglossus kowalevskii; AL=Scaffold; RT=Major
Sequence
MNGGTCGTTGTVYTCSCPTGWGGTNCNIYVASGCVSNTCLNAGVCYVQENGEHVCVCQDG
FKGSNCETVANPAVCTADTCKHNGACHAVGDETLTYLCKCSPEWRGTNCEISVLIPPCDS
NPCQNDGTCAETSEGFSCICREGYGGTACETDINECLSDPCQNGGSCYDKTFGYTCICSD
MYTGPHCEDEYAYLSGSPIAVHSPGVMLISFILITIFLR
Download sequence
Identical sequences XP_006817917.1.86028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]