SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_006820405.1.86028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006820405.1.86028
Domain Number 1 Region: 226-331
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-25
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 2 Region: 38-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-23
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 3 Region: 143-181
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 4 Region: 418-451
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 186-222
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000929
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 374-419
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000034
Family LDL receptor-like module 0.0021
Further Details:      
 
Weak hits

Sequence:  XP_006820405.1.86028
Domain Number - Region: 335-372
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000295
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006820405.1.86028
Sequence length 690
Comment PREDICTED: low-density lipoprotein receptor-related protein 12-like [Saccoglossus kowalevskii]; AA=GCF_000003605.2; RF=representative genome; TAX=10224; STAX=10224; NAME=Saccoglossus kowalevskii; AL=Scaffold; RT=Major
Sequence
MYREKWNLSVSVIVILLLPVAASNTDNEDCPNYGQRSSRQGNIASINYPQLYPPDKDCSW
FISSEHDHIIISFLAFDLEDGTLCENDYLEYGPALGGSVKLCGSQLPNPIISTRDHVWLK
FHTNTKIQRSGFLLTYVASSNSTPCRNGEFQCSNQLCILNEWRCNGKSECGDGSDEDPQL
CKPASSCAIHSFACSTTDTCLPEFRQCDGINDCPDGSDEQYCPEYCKHSLDGEVGYFTSP
NYPHPYANNMSCSWTILSTVNTIQLRFVEFQLQENDFLIAYDGDDIYQEELTHLYGGDKV
PHVIESTHSRMLVVFKSDAKLVSKGFNATYQHKGICLDTQVLCGDESNCYDPEIARCNDY
FDCTDGEDELGCRDCKSDEFACWNGKNCFSQDDHCSGKPRCADGSDEYNCNALICNSDRG
LFLCGNKQCIFESWQCDGTDDCGDGSDENYCPGILSTRVITAAVIGSLVCGLLLVIALGC
TCKLYALRLSEQHPYGRSSPMRRLEQEFMRREAPPTYAETVASSTEPGDHATSAFMQQIH
ALSRARRSRRPRRPRSRALVISVADENPVENCDQESSATHRDEEGDVDTDTETNHDAQHL
RNLDPQIADAVSNVQQLQNIISGAEFGEEDANDNAASCDDASAADIDNDDGAPDDNVSIN
ASSSGDDDNNQLPIESDSTRLLSNQTDSTC
Download sequence
Identical sequences Sakowv30020525m XP_006820405.1.86028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]