SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006868747.1.41390 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006868747.1.41390
Domain Number 1 Region: 57-553
Classification Level Classification E-value
Superfamily Sema domain 3.92e-100
Family Sema domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1417-1542,1708-1864
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.92e-33
Family p120GAP domain-like 0.018
Further Details:      
 
Domain Number 3 Region: 894-985
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000369
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 4 Region: 985-1075
Classification Level Classification E-value
Superfamily E set domains 0.000000000000356
Family Other IPT/TIG domains 0.038
Further Details:      
 
Domain Number 5 Region: 1073-1153
Classification Level Classification E-value
Superfamily E set domains 0.0000000000496
Family E-set domains of sugar-utilizing enzymes 0.087
Further Details:      
 
Domain Number 6 Region: 556-608
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000471
Family Plexin repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006868747.1.41390
Sequence length 1932
Comment PREDICTED: plexin-D1, partial [Chrysochloris asiatica]; AA=GCF_000296735.1; RF=representative genome; TAX=185453; STAX=185453; NAME=Chrysochloris asiatica; AL=Scaffold; RT=Major
Sequence
ARRAAGGATLSAPAAAASPLPARSPFRPPPRPQVPLLRPLFLLLLLGVARAGALEIQRRF
PSPTPTNNFVLDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVADSPLCHAPQLPQAS
CEHPRRLTDNYNKILQLDTGQGLVVVCGSIYQGFCQLRRRGNISAVAVHFPPAGPPAEPV
TVFPSMLNVAANHPNASTVGLVLPPASGTGGSRLLVGATYTGYGSAFFPRNRSLEDHRFE
NTPEIAIRSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHPPDSLSRA
PSYAYLALNSEARAGDKESQARSLLARICLPRGASGDAKKLTESYIQLGLQCAGGAGRGD
LYSRLVSVFPARERLFAVFERPPGGPTARAAPAALCAFSFADVQAAIRTARTACFVQPAP
DVVAVLDSVVQGTGPACERKRNIQLQPEQLDCGAAHLQHPLSVLQPLKATPVFRAPGLTA
VAVAGVNNYTVVFLGTVSGRLLKINLNESMQVVSRRVVTVAYGEPVHHIMQFDPVDPGYL
YLMTSHQMARVKVAACYVHSTCEDCVGAADAYCGWCALETRCTLQQDCANSSQQHFWTSA
SEGTSRCPAMTVLPAEIDVLREYPGMILQLSGSLPDLSGMEMACDYGNEVRTIARVPGPA
FSHQIAYCNLLPRDRFPPFPPNQDHVNVEMSVRVNGRNIVRANFTIYDCSRIGQVYPHTA
CISCLSTQWPCFWCAQQHTCASNQSQCEASPNLTSPQDCPQILPSPLAPVPTGGSQNFLV
PLANASFFQGTALECSFGPEEIFEATWVNESTVCCNQVVLHTTQKSQVFPLSLQLKGRPA
RFLDSLDPMTVEIYNCAMGSPDCSQCLGRADLGHLCMWSDGCRLRGPLQPLEDSCPAPEI
YTIEPQSGPLDGGTLLTIRGRNLGRRLRDVAHGVWIGGVACEPLADRYTVSEEIVCATGP
AQGPFSDVVTVNASKEGRSRERFSYVLPLVHSVEPAVGPKAGGTRITIRGSHLDVGSELQ
VLLNDTEPCTDLQRTATNISCTAPGGALPVPVPVCVRFERQGCTRGNLTFRYMRNPVITA
ISPRRSLVSGGRTITVAGERFHMVQNVSMTVHHIGREPTLCKVLNSTLITCPSPGALSNT
SAPVDFFINGRVYADEAALAEELLDPEEVQRGSRFRLDYLPDPQFSTAKREKWIKHHPGE
PLTLVIHKEQDGLGLESHEYRVKIGQVACDIQIVSDRVIHCSVNESLGATEGQLPITIQV
GNFNQTIATLQLGGSETAIIVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEE
MESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVL
PSQALNSQGSSVVQETHPLLGEWKIPESCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQ
KDFAVRDRCSLASLLTVALHGKLEYYTSIMKDLLVDLIDASAAKNPKLMLRRTESVVEKM
LTNWMSICMYSCLRETVGEPFFLLLCAIKQQVNKGSIDAITGKARYTLNEEWLLRENIEA
KPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFAS
STQSYVLRDLDDTSVMEDGRKKLNTLAHYKIPEGASLAMSLTDKKDNTLGRVKDLDTEKY
FHLVLPTDELVEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKP
PLAVKYFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDA
CLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMTPLSEQEM
NAHLAEESRKYQNEFNTNVAMAEIYKYAKRYRPQIMAALEANPAAGRTQLQHKFEQVVAL
MEDNIYECYSEA
Download sequence
Identical sequences XP_006868747.1.41390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]