SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006869129.1.41390 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006869129.1.41390
Domain Number 1 Region: 566-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 230-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 3 Region: 510-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.29e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 454-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.24e-24
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 342-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 398-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 7 Region: 174-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.91e-23
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 286-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.6e-22
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 9 Region: 118-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.27e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 10 Region: 608-660
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.87e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 11 Region: 6-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-16
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 12 Region: 82-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000263
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006869129.1.41390
Sequence length 671
Comment PREDICTED: zinc finger protein 420-like [Chrysochloris asiatica]; AA=GCF_000296735.1; RF=representative genome; TAX=185453; STAX=185453; NAME=Chrysochloris asiatica; AL=Scaffold; RT=Major
Sequence
MVSGVDSVVFDDVAVVFSPEEWALLNLAQRKLYRDVMKETLSNLDSCESIDRVCRYQTLR
ECCEFGKAFKHPATSHVGFNICQCVECGETCSCPSHLTKHERTYNGERPYECKECGKAFW
HLSVFSKHIRTHSGERPYECQECGKTFSDSSILTKHIRTHGEVKPYECKECGKSFRQLST
LTEHVRIHSGERPYKCNECEKAFINASSLTEHIRTHNEEKPYECMECGKAFWHLSVLSKH
IRTHSGERPYECQECGKAFSQASSLTRHIRTHSGERPYECQECGKAFSDSSTLSRHVRTH
SEVKPYECKECGKSFKELSTLTEHVRIHNGERPYKCNECEKAFVNASSLTEHTRTHSGER
PYICKECGKAFTHASSLTEHIRTHSGERPYECKECGKAFWHLSVLSKHLRTHSGETPYEC
QECGKAFSQASSLTRHTRTHSGERPYKCKQCGKAFSDSSALTRHIRTHSGVKPYECKECG
KSFRQLSTLTEHIRIHSGERPYKCKECEKAFINASSLTEHIRTHSGERPYICKECGKAFT
HASSLTEHIRTHSGERPYECKECGKAFRQASSLIKHIRTHSGERPYECKECGKAFSQASS
LIKHKRTHTGERPYKCKECGKSFTHASSLTRHKRTHGRQRPYECKECGRSFRQLSALTKH
IITHWREALYM
Download sequence
Identical sequences XP_006869129.1.41390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]