SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006871604.1.41390 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006871604.1.41390
Domain Number 1 Region: 216-393
Classification Level Classification E-value
Superfamily MIR domain 1.96e-47
Family MIR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 1066-1207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.91e-18
Family SPRY domain 0.031
Further Details:      
 
Domain Number 3 Region: 659-810
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000396
Family SPRY domain 0.053
Further Details:      
 
Domain Number 4 Region: 102-186
Classification Level Classification E-value
Superfamily MIR domain 0.00000863
Family MIR domain 0.028
Further Details:      
 
Domain Number 5 Region: 2193-2265
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000011
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Domain Number 6 Region: 4052-4130
Classification Level Classification E-value
Superfamily EF-hand 0.000014
Family Calmodulin-like 0.041
Further Details:      
 
Domain Number 7 Region: 441-551
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000144
Family IP3 receptor type 1 binding core, domain 2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006871604.1.41390
Sequence length 5018
Comment PREDICTED: ryanodine receptor 1 [Chrysochloris asiatica]; AA=GCF_000296735.1; RF=representative genome; TAX=185453; STAX=185453; NAME=Chrysochloris asiatica; AL=Scaffold; RT=Major
Sequence
MGDGGEGEDDVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPP
DLAICCFVLEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLSC
LTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDLILVSVSSERYL
HLSTASGELQADASFMQTLWNMNPICSCCEEGYVTGGHVLRLFHGHMDECLTISPSDSED
QRRLVHYEGGAVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLGLTEDQGLV
VVDAAKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYA
APDPKALRLGVLKRKAMLHQEGHMDDALSLTRCQQEESQAARMIYSTSGLYNLFIKGLDS
FSGKPRGAGTPAGTALPIEGVILSLQDLIGYFEPPSEELQHEEKQSKLRSLRNRQSLFQE
EGMLSLVLNCIDRLNVYSTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRTNCALF
STNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVL
DVLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTSLINYVTSIRPNIFVGRAEGSTQYG
KWYFEVMVDEVVPFLTAQPTHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLH
LWTGHVARPVTSPGQHLLAPEDVVSCCLDLSVPSISFRINGCPVQGVFEAFNLDGLFFPV
VSFSAGVKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLEPIKEYRREGPRGPHLV
GPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDN
KRLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYM
MSNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSSVQDIPARRNPR
LVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVERQSRWDRVRIFRAERS
YTVQSGRWYFEFEAVTTGEMRVGWARPELRPDIELGADELAYVFNGHRGQRWHLGSEPFG
RPWQSGDVVGCMIDLSENNIIFTLNGEILMSDSGSETAFRDIEIGDGFLPVCSLGPGQVG
HLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFEAVPLEHPHYEVSRV
DGTVDTPPCLRLTHRTWGSQNSLVEMLFLRMSLPVQFYQHFRCTAGATPLAPPGLQPPAE
DEARAAEPDPDYENLRRSAGRWGEAEGGKEATAKEGAPGGTPQAGVEAQPTKLENEKDAT
TEKNKKRGFLFKAKKAAMMTQPPATPTLPRLPREVVPADNRDDPDIILNTTTYYYSVRVF
AGQEPSCVWVGWVTPDYHQHDMNFDLSKVRTVTVTMGDEQGNVHSSLKCSNCYMVWGGDF
VNPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAAFVLPTHQN
VIQFELGKLKNIMPLSAAMFLSERKNPAPQCPPRLEVQMLMPVSWSRMPNHFLQVETRRA
SERLGWALQCEEPLIMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNTR
VAHALCSHVDQAQLLHTLEDAHLPGALRAGYYDLLISIHLESACRSRRSMLSEYIVPLTP
ETCSITLFPPEKGADNGPRRHGLPGVGVTTSLRPPHHFSPPCFVAALPNAKIAEAPARLS
PAIPLEALRDRALRMMGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGVFGDEDV
KQILKMIEPEVFTEEEEEEEEEEEEEDEEEKEEDEEEEAEEKEDEEKEEEEEAAEGEKEG
LEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDNLQDNQRSRYGLLM
KAFTMSAAETARRTREFRSPPQEQINMLLHFKDGNDEEECPLPDDLRQELLDFHQDLLAH
CGIQLEGEEEEPEEEATLGSRLMSLLEKVRLVKKKEEKADEEPPAEESKPQSLQELVSHT
MVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRAMPRAYTISLSSVEDTMSLLECLSQ
IRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESK
EIRFPKMVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAASVI
DNNELALALQEQDLEKVVSYLAGCGLQSCPMLLAKGYPDIGWNPGGGERYLDFLRFAVFV
NGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLGAIEEAIRISEDPARDGPGVRRDR
RREHFGEEHPEENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLV
PLDDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLHV
LDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDS
MLHTIYRLSRGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKMPL
KLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDQELYRMVMP
CLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKYAEY
THEKWAFDKIQNNWSYGENIDEDLKTHHMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEW
TVEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSVVTLSRELQAMAEQLAEN
YHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGL
KDMELDTSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFAKI
LLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTDA
RAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQ
VKGVGQNLTYTTVALLPVLTTLFQHIAQHHFGDDVILDDVQVSCYRTLCSIYSLGTTKST
YVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMCP
DIPVLERLMADIGGLAVSGARYTEMPHVIEITLPMLCSYLPRWWEHGPEAPAPSLPASAP
PPCTAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLHSHFIPT
IGRLRKRAGKVVAEEEQLRLEAKAEAEEGEMQVRDEFSVLCRDLYALYPLLIRYVDNNRA
HWLTEPNSNAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKT
GDVQSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQELITLAKIRYA
LKDTDEEVREFLQNNLHLQGKVEGSPSLRWQMALYRGLPGREEEADDPEKIVRRVQEVSA
VLYHLEQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAW
IVTEDHNFEDRMIDDLSKAGEQEEEEEEEEEKKPDPLHQLVLHFSRTALTEKSKLDEDYL
YMAYADIMAKSCHLEEAEEGVEGEEEVEVSFEEKEMEKQRLLYQQARLHNRGAAEMVLQM
ISACKGETGSMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVL
DLNAFERQNKAEGLGMVKEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNDFQNY
LRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVF
NSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHLMMKLAQDSSQIGLLKELLDLQKD
MVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIMGSEAFQDYVT
DPRGLISKKDFQKAMDSQKQFTGPEIQFLLSCSEADENEMINCEEFANRFEEPARDIGFN
VAVLLTNLSEHVPHDQRLRSFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNR
AQWEMPQVKESKRQFIFDVVNEGGEAEKMELFVSFCEDTIFEMQIAAQISEPEGEPPEDD
DEGTAETGAEGADTGDAGAEGTPGPAAAGLPARLAAVAGWALRGLSYRSWGNSECKGPEV
AAARRAGAAGAGAAAGAIRLLWGSLFGGGLVEGAKKVTVTELLAGMPDPTGDEVHGEQSA
GTGDDADGEGTSDAAEGAGDEEATREAGQGGADGAVAVAEGGPFRPEGPAGGLGDMGDTT
PVEPPTPEGSPILKRKLGVEGAEEMLPEPEPEPEPEPEPEKADAENGEKEEIPEPPPEPT
SKAPPPAPSKKEETKGGGMEFWGELEVQRVKFLNYLSRNFYTLRFLALFLAFAINFILLF
YKVSDSPPGEDDTEGSAVGDLSGAGSGDGSGWGSGAGEEAEGDEDENLVYYFLEESTGYM
EPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELARKLEFDGLYITEQPEDDDVKG
QWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIYGRERIAELLGMDLASLEITAHNDRKPT
PSPGLLTWLMSIDVKYQIWKFGVIFTDNSFLYLGWYMVMSLLGHYNNFFFAAHLLDIAMG
VKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDM
MTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDA
FGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKD
ETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences XP_006871604.1.41390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]