SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006899802.1.29581 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006899802.1.29581
Domain Number 1 Region: 216-393
Classification Level Classification E-value
Superfamily MIR domain 1.44e-46
Family MIR domain 0.0027
Further Details:      
 
Domain Number 2 Region: 1080-1207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.8e-18
Family SPRY domain 0.039
Further Details:      
 
Domain Number 3 Region: 656-795
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000506
Family Legume lectins 0.086
Further Details:      
 
Domain Number 4 Region: 441-551
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000811
Family IP3 receptor type 1 binding core, domain 2 0.012
Further Details:      
 
Domain Number 5 Region: 102-186
Classification Level Classification E-value
Superfamily MIR domain 0.00000942
Family MIR domain 0.028
Further Details:      
 
Domain Number 6 Region: 2188-2258
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000131
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Domain Number 7 Region: 4045-4122
Classification Level Classification E-value
Superfamily EF-hand 0.000074
Family Calmodulin-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006899802.1.29581
Sequence length 4932
Comment PREDICTED: ryanodine receptor 1 [Elephantulus edwardii]; AA=GCF_000299155.1; RF=representative genome; TAX=28737; STAX=28737; NAME=Elephantulus edwardii; AL=Scaffold; RT=Major
Sequence
MGDGGEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPP
DLAICCFVLEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLSC
LTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDLILVSVSSERYL
HLSTASGELQVDASFMQTLWNMNPICSGCEEGYVTGGHVLRLFHGHMDECLTISPADSED
QRRLVHYEGGAVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLGLMEDQGLV
VLDASKAHTKATSFCFRISKEKLDMAPKRDIEGMGPPEIKYGESLCFVQHVASGLWLTYA
APDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIYSTAGLYNLFIKGLDS
FSGKPRGGGPPAGTALPIEGVILSLQDLIGYFEPPSEELQHEEKQTKLRSLRNRQSLFQE
EGMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRTNCALF
STNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVL
DVLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIYVGRAEGSTQYG
KWYFEVMVDEVVPFLTAQPTHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLH
LWTGHVARPVTSPGQHLLAPEDVVSCCLDLSVPSISFRINGCPVQGVFEAFNLDGLFFPV
VSFSAGVKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPREKLHLEPIKEYRREGPRGPHLV
GPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDN
KRLHPCLVNFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYM
MSNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPR
LVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVESQSRWDRVRIFRAERS
YAVQSGRWYFEFEAVTTGEMRVGWARPELRPDIELGADDLAYVFNGHRGQRWHLGSEPFG
RPWQSGDVVGCMIDLSENNIIFTLNGEVLMSDSGSETAFRDIEIGDGFLPVCSLGPGQVG
HLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFEPVPPEHPHYEVSRV
DGTVDTPPCLRLTHRTWGSQNSLVEMVFLRMSLPVQFYQHFRCTAGATPLAAPGMQPPAE
DEARAAEPDPDYENLRRSAGRWGEAEGGKEGTAKEGVPGGTPQAGAEAQTTRAENEKDAT
TEKNKKRGFLFKAKKAAMMTQPPATPTLPRLPRDVVPADDRDDPEIILNTTTYYYSVRIF
AGQEPSCVWVGWVTPDYHQHDMNFDLNKVRAVTVTMGDEQGNVHSSLKCSNCYMVWGGDF
VSPGQQGRISNTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPATFVLPTHQN
VVQFELGKLKNIMPLSAAMFLSERKNPAPQCPPRLEVQMLMPVSWSRMPNHFLQVETQRA
GERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNR
VAHALCSHVDQSLLLHALEDAHLPGPLRAGYYDLLISIHLESACRSRRTMLSEYIVPLTP
ETRSITLFPPGKRVDNGPRRHGLPGVGVTTSLRPPHHFSEPCFVAALPAAGVGEAPASLS
PSIPLEALRDRALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGVFDDEDV
KQILKMIEPEVFTEEEEEEEEEEEEEDEEEKEEDEEEEAEEKEEAAEGEKEEGLEEGLLQ
MKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRGRYGLLMKAFTMSA
AETARRTREFRSPPQEQINMLLHFKDGADEEDCPLPEDIRQDLLEFHQDLLAHCGIQLEG
EEEEPEEEATLASRLISLLEKVRLVKKKEEAPEEEPPAEESKPQSLQELVSHTVVRWAQE
DFVQSPELVRAMFSLLHRQYDSLGELLRALPRAYTISPSSMEDTMSLLECLSQIRSLLIV
QMGPQEENLMIQSIGNIMNNRVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKM
VTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELAL
ALQEQDLEKVVSYLAGCGLQSCPMLLAKGYPDIGWNPCGGERYLDFLRFAVFVNGESVEE
NANVVVRLLIRKPECFGPALRGEGGSGLLGAIEEAIRISEDPARDGPGVRRDRRREHFGE
EPPEENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLDDLVG
IISLPLQIPALGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLHVLDVGFLP
DMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYR
LSRGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHY
ERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDQELYRMAMPCLCAIAG
ALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKYAEYTHEKWAF
DKIQNNWSYGENIDEELKTHHMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKARE
GEEEKTEKKKTRKISQTAQTYDPREGYNPQPPDLCGVTLSRELQAMAEQLAENYHNTWGR
KKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDT
SSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQ
YFTNHCLYFLSTPAKLLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTDAPAVVNCL
HILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQN
LTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTKGTYVEKLRP
ALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMCPDIPVLER
LMADIGGLAVSGARYTEMPHVIEITLPMLCSYLPRWWEYGPEAPPPSLAAGAPPPCTAVT
SDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLHSHFIPTIGRLRKR
AGKVVAEEEQLRLEAKAEAEEGELLVRDEFSVLCRDLYALYPLLIRYVDNNRAQWLTEPN
PNAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKAGDVQSGG
SDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQELITLAKTRYALKDTDEE
VREYLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDTDDPEKIVRRVQEVSAVLYHLEQ
TEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAAWILTEDHS
FEDRMIDDLSKAGEQEEEEEEEEEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADI
MAKSCHLEETEENVEAEEEVEVSFEEKEMEKQRLLYQQARLHNRGAAEMVLQMISACKGE
TGSMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFER
QNKAEGLGMVKEDGTVNNRQNGEKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGN
TTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLTEYI
QGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIGLLKELLDLQKDMVVMLLS
LLEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIMGSEAFQDYIVDPRGLIS
KKDFQKAMDSQKQFTGPEIQFLLSCSEADENEMINCEEFASRFEEPARDIGFNVAVLLTN
LSEHVPHDQRLRSFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQ
VKESKRQFIFDVVNEGGEAEKMELFVSFCEDTIFEMQIAAQISEPEGEPPEDEDEGAEAG
AEGAEAGTGAKKVTVTELLAGMPDPTGDEVHGEQQAGAGEDADGEGAGEAAEGAGDEEAA
AGETGAGGGDGAVAVAEGGPFRPEGAGGLGDMGDTTPVEPPTPEGSPILKRKLGVEGEEE
ELPPEPEPEPELEKADAENGEKEEIPEPEPETPEKTAPPPHPPKKEEAKGGGMEFWEELE
VQRVKFLNYLSRNFYTLRFLALFLAFAINFILLFYKVSDSPPGEEDMEGSAAGDLSGAGS
GGGSGWGSGAGEETEGDEDENMVYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLK
VPLVIFKREKELARKLEFDGFYITEQPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKRKVL
EKHGDIYGRERIAELLGMDLASLEITAHNERKPEPPPGLLTWLMSIDVKYQIWKFGVIFT
DNSFLYLGWYMVMSLLGHYNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLA
VVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPA
GDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGS
DYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAG
DCFRKQYEDQLS
Download sequence
Identical sequences XP_006899802.1.29581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]