SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006901113.1.29581 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006901113.1.29581
Domain Number 1 Region: 24-520
Classification Level Classification E-value
Superfamily Sema domain 1.44e-100
Family Sema domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1384-1509,1675-1831
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.31e-33
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 861-952
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000624
Family Other IPT/TIG domains 0.019
Further Details:      
 
Domain Number 4 Region: 952-1041
Classification Level Classification E-value
Superfamily E set domains 0.00000000000573
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.076
Further Details:      
 
Domain Number 5 Region: 1040-1120
Classification Level Classification E-value
Superfamily E set domains 0.00000000028
Family E-set domains of sugar-utilizing enzymes 0.087
Further Details:      
 
Domain Number 6 Region: 523-574
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000767
Family Plexin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006901113.1.29581
Sequence length 1899
Comment PREDICTED: plexin-D1, partial [Elephantulus edwardii]; AA=GCF_000299155.1; RF=representative genome; TAX=28737; STAX=28737; NAME=Elephantulus edwardii; AL=Scaffold; RT=Major
Sequence
VPPLCALLPLLLLRAAQAGALEIQRRFPSPTPTNNFVLDGAAGTVYLAAVNRLYQLSGAN
LSLEAEAAVGPVADSPLCHAPQLPQASCEHPRRLTDNYNKILQLDPGQGLVVVCGSIYQG
FCQLRRRGNISAVAVHFPPAVPDAEPVTVFPSMLNVAANHPNASTVGLVLPPAAGAGGSR
LLVGATYTGYGSAFFPRNRSLEDHRFENTPEIAIRSLDARGDLAKLFTFDLNPSDDNILK
IKQGAKEQHKLGFVRAFLHPPDSPPGAPSYAYLALNSEARAGDKESQSRSLLARICLPRG
AGGDAKKLTESYIQLGLQCAGGAGRGDIYSRLVSVFPARELLFAVFERPPGVPTARAAPA
ALCAFHFADVQEAIRAARTACFVDPAPDVVAVLDSVVQGTGPACERKRNIQLQPEQLDCG
AAHLQHPLSILQPLKATPVFRAPGLTSVAVANVNSYTVVFLGTVSGRLLKINLNESMHVV
SRRVVTVAYGEPVHHIMQFDPADPGYLYLMTSHQMARVKVAACEVHSTCKDCVGTADAYC
GWCALETRCTLQQDCTNSSLQHFWTSASEGTGRCPTMTVLPAEIDVHQEYPGMILQLSGS
LPSLSGMDMACDYGNDIQTVARVPGPAFSQQIAYCNLLPKDQFPPFPPNQDHINVEMSVQ
VNGRNIVRANFTIYDCSRIGQVYPHTACTSCLSTQWPCFWCTQQHACVSNQSLCAASPKL
TIPQDCPQILPSSLAPVPTGGSQNILVSLANASIFLGTALECSFGSEDIFEAVWVNESTV
RCNQVVLHTTQKSQVFPLSLQLKGRPARFLDSLDPMKVEVYNCAMGSPDCSQCLGREDLG
QLCVWNNGCRLRGALQPLPGSCPAPEIHSIEPLSGPLDGGTLLTIRGRNLGQRFKDVTQA
VWIGDVACEPLADRYAVSEQIVCATGPALRPFSDVVTVNASKEGRSKERFSYVLPLVHFL
EPAMGPKAGGTRITIHGGHLDVGSELQVLVNDTEPCTDLVRAATSISCTVPSGTLAASVA
VCVRFESQGCVRGNLTFWYMRNPVITAMSPQRSLVSGGRTITVAGERFHMVQNVSMTVHQ
IGREPTLCKVVNATLITCPSPGALSNASAPVDFFINGRVYADEAAGAEELLDPEEVQRGS
RFRLDYLPDPQFSTAKREKWIKHHPGEPLTLVIHKEQDGLGLESHEYRVKIGQVACDIQL
VSDRVIHCSVNESLGATEGQLPITIRVGNFNQTIATLQLGGSETAIIVSIVICSVLLLLS
VVALFVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGI
PFLEYKHFVTRTFFPKCSSLYEERYVLPSQTLNSQGSSPVQETHPLLGEWKIPESCRPNM
EEGISLFSSLLNNKHFLIVFVHALEQQKDFAVRDRCSLASLLTVALHGKLEYYTSIMKEL
LVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSCLRETVGEPFFLLLCAIKQQIN
KGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEK
ILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYVLRDLDDTSVVEDGRKKLNTLAHYKIPE
GASLAMSLTDKKDNTLGRVKDLDTEKYFHLVLPTDELSEPKKSHRQSHRKKVLPEIYLTR
LLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYFFDFLEEQAEKRGISDPDTLHIWKTNS
LPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAK
EIPEYRKIVQRYYKQIHDMTPLSEQEMNAHLAEESRKYQNEFNTNVAMAEIYKYAKRYRL
QIMTALEANPAARRTQLQHKFEQVVALMEDNIYECYSEA
Download sequence
Identical sequences XP_006901113.1.29581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]