SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006907964.1.64745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006907964.1.64745
Domain Number 1 Region: 252-429
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.36e-30
Family Laminin G-like module 0.09
Further Details:      
 
Domain Number 2 Region: 1514-1588
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000334
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 674-819
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000000000123
Family Matrix metalloproteases, catalytic domain 0.083
Further Details:      
 
Domain Number 4 Region: 1458-1520
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000106
Family Complement control module/SCR domain 0.0063
Further Details:      
 
Domain Number 5 Region: 1583-1643
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000681
Family Complement control module/SCR domain 0.0052
Further Details:      
 
Domain Number 6 Region: 529-621,710-761
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000304
Family Zinc protease 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006907964.1.64745
Sequence length 1756
Comment PREDICTED: pappalysin-2 [Pteropus alecto]; AA=GCF_000325575.1; RF=representative genome; TAX=9402; STAX=9402; NAME=Pteropus alecto; AL=Scaffold; RT=Major
Sequence
MKCSKILGISLVILAGWALGTAGSEPGRTRKRSLAQIGHLQQLLSEGDRCWLGAKVRRPR
ASPQHHLFGVYPSRPGSYLRPYPVGDLGPHHAGRSEPATEGMAGAGVSGEAEQPAAPWGG
DGPIGQSAPLGDDDIYLDDGGSKLSLREAGTRERSATAAAVTARFAHRKEPRLGTRGKGR
AKTRRRRQVAKGQAEGVQADPDASPRHFQPLPKRPLMLRVRTSALEDSIQNGEGDPSWEA
ETSQPRGGRLPVLYFSGRRERLRLRPEVLAEIPREAFTVEAWVNPEGGQSNPAIITGVFD
NCSHTVSDKGWALGIRSGKDTGRRDARFFFSLRTDRVKKATVVTGHGRYQPGTWTHVAAT
YDGRRMALYVDGTQVASSPEQSGPLHSPFMSSCRSVLLGGDSSEHGHHFRGHLGTLVFWS
TALSQSHLQHSPQHPSGVEELTTLVLTASFEPLEEQWAPFREEKYPRLEVLQGFELEPEI
LSPLQPPLCGRTACDNVELISQYNGHWPLRGEKVIRYQVVNICDDEGLNPTVSEQQIRRQ
HEALNEAFGRYNITWQLSVQRVHNSTLRLRVVLVGCEPGKIGNDHCDPECEHPLTGYDGG
DCRLHGRCYSWNRRDGLCHVECNNMLNDFDDGDCCDPEVADVHKTCFDPDSPRRAYMSVK
ELKEALQLNSTHFLNVYFASSVKEDLAGAATWPWDKEAISHLGGVVLNPAYYGMPGHTNI
MIHEVGHVLGLYHVFKGVSERESCDDPCRETVPSMETGDLCADTAPTPKSKLCQDPEPTN
DTCGVTHFPGAPFSNYMSYTDDDCTDSFTPNQVARMHCYLDLVYQQWSQSQKPTPIPIPP
MVVGQTGKSLTIHWLPPISGVVYDRSLGSVCDACAEDGTFRQYVHSASSRRVCDSSGYWT
PEEAVGPPDVDQPCEPSLQAWSPELHLYHMNMTVPCPAEGCSLELLFRHPVQADTLTLWV
TYLSMDSPQALFDVEILLEHRESVHLGPLDTSCDTPLTVKLHVDGEVSGVKVYTFDERME
IDAALLASRPRSPLCSGCRPVTYQVLREPPFASGSPAAVTHPHRKFTDVEVRPGQMYQYQ
VQAVAGAELGEASPPLSHVHGAPYCGDGKVARSLGEECDDGDLLSGDGCSRACELEEGFK
CVGEPSLCYIYEGDGICEPFEKEASLIDCGLYTPDGYLDQWATHASSSHEDKNKCPVSVV
TGEPHSMICTSYHPDLPEQRPLAGWFPCVTSGNGPRGEGSEQREGSLERDDEVWLKVCFS
RPGVAVAIFVFLASDGLASGKHPRPTATLHLTDVNGNNHSLGTYELSCQQNPLVINVTHR
PDVLAHHTTAALLNFSSSLVGISAVALRTSSHTSLSAPNNCIPEHEGRNHQGQSCVHRPC
GEQGSCAPLPLDHADVVNCTSDGPGHMKCAITCQKGFALQDSSGQYLRPLQKEILLTCSS
GHWDRAVSCMALDCGVPDPSLVNHATFSCSEGTNFRKRCAISCVPPAKLQGLSPWLTCLE
DGLWSLPEAYCKLECDAPPVIPNANLLLPHCLQGHHDVGSVCRYECKPGYYVLESAERKL
RNMFLKIQCLEGGTWEQGSCVPVVCEPPSPVFEGMYECTNGFQFNSQCMLSCHQESERLP
TRCTKEGLWTEEFRLCEKMQGECPPPPSGLNSVEYKCEQGFGIGAVCSPSCMIPPNDPVI
LPENVTTDTLEHWMEPVKVQSIVCTGRRQWHPDPVLVHCIQSCESSTINNRKVIPFAADC
DSDECTCRDPKAEENQ
Download sequence
Identical sequences XP_006907964.1.64745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]