SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006927292.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_006927292.1.62641
Domain Number - Region: 105-164
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000889
Family Myosin rod fragments 0.025
Further Details:      
 
Domain Number - Region: 38-135
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00403
Family Spectrin repeat 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006927292.1.62641
Sequence length 214
Comment PREDICTED: coiled-coil domain-containing protein 169 isoform X1 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MEEGRGANFDGVSTDRLEKELLEEIHQKDIVQLSMLEIIHKIEELEAKLNTDDKGGEWKV
RYETQLELNDQLEKQIVSLEEKMKKICGNPSDRLSFIRVYEKMPVESLNILLKQLEKEKR
RLKNQVKDYALRLEQESKAYHKTNNECHTYLAEMSQVSDSYQVSKRQQMDQLPRMKENSV
KMVRYNPVNQKTMNAKRGPGKKITRSNHLPKLDP
Download sequence
Identical sequences A0A2I2UXQ1
XP_006927292.1.62641 ENSFCAP00000008145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]