SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006955640.1.58810 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006955640.1.58810
Domain Number 1 Region: 18-56
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000445
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006955640.1.58810
Sequence length 102
Comment PBD-domain-containing protein, partial [Wallemia mellicola CBS 633.66]; AA=GCF_000263375.1; RF=representative genome; TAX=671144; STAX=1708541; NAME=Wallemia mellicola CBS 633.66; strain=CBS 633.66; AL=Scaffold; RT=Major
Sequence
LSDLLQLQKKPEISTPYDPVHLTHVGFNSDTGEFTGLPKEWQQLLQDSGISKQDQEANPQ
AVMDIVAFYQDAQKAQLGAEDSQVWKKMGGVANGQPTGPVEK
Download sequence
Identical sequences I4YJA0
XP_006955640.1.58810 jgi|Walse1|9879|gw1.1.538.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]