SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006963342.1.9351 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006963342.1.9351
Domain Number 1 Region: 162-256
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.52e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_006963342.1.9351
Sequence length 257
Comment predicted protein [Trichoderma reesei QM6a]; AA=GCF_000167675.1; RF=representative genome; TAX=431241; STAX=51453; NAME=Trichoderma reesei QM6a; strain=QM6a; AL=Scaffold; RT=Major
Sequence
MPAPTALKKTESTPLVADVPSPAQDNDQEFLLDAPDAAVAEAEVLVPETTDASNSMAIDE
EGRPRFAPSKDIDPMTRVETRKIPIPPHRMTPLKQAWPSIYPPIVEHLKLQCRMNIARKT
VELRTSKSTVDSGALQKGEDFVKAFTLGFDVDDAIALLRLDDLYIETFEIKDVKTVHGDS
QSRAIGRIAGHQGKTKFAIENASRTRIVLADSKIHILGGFKNIHMARESVVSLILGKPPG
KVYGNLRTVAARMKERF
Download sequence
Identical sequences A0A024S9C4 A0A2H2Z6V5 G0RDC7
51453.JGI120571 XP_006963342.1.9351 jgi|Trire2|120571|estExt_fgenesh5_pg.C_40050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]