SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006963941.1.9351 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006963941.1.9351
Domain Number 1 Region: 9-641
Classification Level Classification E-value
Superfamily Sec1/munc18-like (SM) proteins 1.44e-136
Family Sec1/munc18-like (SM) proteins 0.00014
Further Details:      
 
Domain Number 2 Region: 1072-1281,1308-1502,1617-1657
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.02e-67
Family FAD-linked reductases, N-terminal domain 0.0001
Further Details:      
 
Domain Number 3 Region: 1483-1603
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.31e-26
Family L-aminoacid/polyamine oxidase 0.00029
Further Details:      
 
Domain Number 4 Region: 963-1062
Classification Level Classification E-value
Superfamily Homeodomain-like 7.62e-24
Family SWIRM domain 0.015
Further Details:      
 
Domain Number 5 Region: 1704-1798
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000131
Family HMG-box 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006963941.1.9351
Sequence length 1851
Comment predicted protein [Trichoderma reesei QM6a]; AA=GCF_000167675.1; RF=representative genome; TAX=431241; STAX=51453; NAME=Trichoderma reesei QM6a; strain=QM6a; AL=Scaffold; RT=Major
Sequence
MAPRAEFSTEQVRGKARKDLLYLLEGVRGKKNLVFDRSLVGPIGTIVKVATLQEYGVDKF
FILENNNVDASQRNVVFVARGECGRHAEAIAAQIKRIQRESQTTHDFHIFWVPRRTLVSD
QLLEEAGVLGDINISELPLLFFPLEDDVLSLELEDSFKDLYLSKDITPNFLMAKALMEVQ
QNHGLFPRIIGKGDNAKRVADLLVRMRQERLAGDDGSDVKTALTPSTTNESVIIIDREVD
FVTPLLTQLTYEGLIDEIFEIQNNQAKVDTTIVGAPAQSSTATSQSRKRTVQLDSSDKLY
EQLRNANFAIVGGLLNKVARRLQKVQSDYESKHKTKTIAELKEFVSQLPGYQQEHQSARI
HTGLAEEIIKHTRTDLFKGLLEVQQNLAAGADPSSQFDGIEELIAREAPLRETLRLLCIY
SCISGGIKPKDLEQFKRLILQGYGYQHLLTLNNLEKLQLFLSRSSPLAGMIPMTANSGAD
GTKTNYAYLRKQLRLIVDEVQEDDPNDIAYVYSGYAPLSIRLVQCILQKQYLLSITKGNG
AANASSVAPGAGTQGWHGFDEAVKHVRGQTFYELQKGEDKAVKARALLSGSGQKQTVFVV
FVGGVTFTEIAALRFIAKQEESRRKIVICTTSIISGNRMMDAAIEKEAFARKEPTKIQSA
APLKSVYYHLKACSAARESLIPARPAVASQPYGLCPVRYAPEPVNPPDDLSCRLQTHSWV
QVLYTPRVRANPVRLADNPDKTGGSHGRFPHHMMRLPSVMLYGLPIGPTFSHPTQDTDSS
SSISSLAAESVAKSQSQVTASPKSVLSSRRVSGLGSSDESSEVAPEIVVWTEDMESEDMD
LSSGLSNHDTEESSSMHLDTDDEKLQHGDDIPLPAEPTEDAIAQSFTSSHSSLSDLSEVL
SSPSIVSSKATTPIETEIPSRPQIGGITQTFSASSSYRHDIERLTFNVRPKSSIPTDIPS
YQYASECIAAAESSRLNPYALHPEEYQFLRHHISHSQVTTYLNIRNGILRMWMKQPSVGV
TRQEAVGCANARWFDAASVCYDWLVRRGYINYGCVQLPEPQPDFRGNEPPTKKRKTIAVI
GAGISGLSCARQLDGLFKQHASHFYSRGEELPKVVILEGRGRVGGRVYSREFKTRPATSE
PEFKGKRYTAEMGGMIITGFDRGNPLNVIVRGQLGIPYHALTAETTIYDSNGKPVDPVRD
LLVEKLYNDCLDRVSEFKYKYQPSKVIEGNRDLLDEGRDSLGDGSKTIIQAEEATAALPD
APSVSQQNVPETVNMVPVSADKLTGRVHTEPGVPGTIKASEKAKLMGWNIKAGAADKANL
DLTQATALEGATLGSVLDYAITQYKNIVDLNAQDHRLINWHIANLEYSNATNLHNLSLGL
WDIDAGNEWEGHHTMVVGGYQSVARGLLQCPSPLEVKTKFAVQKITYHGEGFDGPASIES
EDGTVVEADAVVCTIPLGVLKQGTIQFEPPLPSEKAEAVRRLGFGILNKVVLLYDRVFWD
SDRHIFGVLRDAPNRHSTSQQDYSTNRGRFFQWFNVTNTTGLPCLIALMAGDAGFDTEHT
SNDSLVAEATDILRSVFGKDVPYPIETVVTRWGSDRFARGSYSSAAPDMQPDDYNVMAQP
AGNLFFAGEHTIGTHPATVHGAYLSGLRAASEVLESMIGPIEVPTPLVLPRDSLLLRKRK
EAAKDPRQARLEAYEIEVWEHVLSKIGERPLRPNKVAGSAYILFSKAHFEAAKKRCEESR
KPGRGRSIPNEVRIMTSRMWKEATPEQKRPYEEQVAEQKKRYLEAMQEYNELAEKWDRQA
MALRAAYEEEHPSVPGPEEEGGPEDASSTMAQKRRAKNVSYAEGGDTDADA
Download sequence
Identical sequences G0RFF2
XP_006963941.1.9351 51453.JGI76515 jgi|Trire2|76515|estExt_GeneWisePlus.C_50631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]