SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006973872.1.50099 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006973872.1.50099
Domain Number 1 Region: 233-439
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-32
Family Laminin G-like module 0.047
Further Details:      
 
Domain Number 2 Region: 1521-1595
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000113
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 683-829
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000557
Family Matrix metalloproteases, catalytic domain 0.092
Further Details:      
 
Domain Number 4 Region: 1587-1644
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000945
Family Complement control module/SCR domain 0.0065
Further Details:      
 
Domain Number 5 Region: 1477-1527
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000709
Family Complement control module/SCR domain 0.0066
Further Details:      
 
Domain Number 6 Region: 545-631,720-772
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000982
Family Zinc protease 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006973872.1.50099
Sequence length 1788
Comment PREDICTED: pappalysin-2 [Peromyscus maniculatus bairdii]; AA=GCF_000500345.1; RF=representative genome; TAX=230844; STAX=10042; NAME=Peromyscus maniculatus bairdii; AL=Scaffold; RT=Major
Sequence
MMCWKVLRVSLVVLAGWAFSTTNSELGWTRKKVLAQRGQLNQVLLEGERCWLGTKIRRPR
TAPQHHPFGVYPSRPGSYPRPYAVAKKRTQNAGWSPPDMERQAPSMVLRDLPENPAGVRR
EPEQPAALWVGDGPIGQSELLRDDDIYVGNGGSKEALGESVTRGSSETAASTITTFAYQK
RPTAETRRKDQARSRLPRQVLRRQAEDVTRDSQNAPLDFQLWPKNSLKHGDSDSPLEGTI
QNGGGGSAWGAETFNPQGGLPVLYFSGKRERLLLRPEVLAEIPREAFTVEAWVKPEGGQS
NPAIIAGVFDNCSHTANDKGWALGIRSGKDKGRRDARFFFSLRTDRVKKATIVTGHSRYQ
PGTWTHVAATYDGQHIALYVDGTRVARSPDQSGPLNSPFMASCRSLLLGGDSSEDGHYFR
GYLGTLVIWSTALSQTHLQHSPQHPSGADELTTLILTATFNPLKEQWAPFRDETYPRLEV
LQDSESQPEILSPLQPPPCGQTACDNVELISQYNEHGPLRGEKVIRYQVVNICDDEGLHP
IVSDDQIRRQHEALNEAFSRYNISWQLSVHQVHNSTLRHRVVLVNCEPSKIGNDHCDPEC
EHPLTGYDGGDCRLQGRCYSWNRRDGLCHVACNNMLNDFDDGDCCDPEVTDVRKTCFDPD
SPKRAYMSVKELKEALQLNSSHFLNVYFASSVREDLAGAATWPWDKEAVSHLGGVVLNPA
YYGMPGHTNIMIHEVGHVLGLYHVFKGVSERESCDDPCRETVPSMETGDLCADTAPTPKS
KLCRDPEPANDTCGLTHFPGAPFRNYMSYTDDECTDSFTPNQVARMHCYLDLVYQQWSES
RKPTPIPIPPMVIGQTNKSLTIHWLPPISGVVYDRAPGSMCGACTEDGTFRQYVYKASSG
RVCDSSGYWTPEEAVGPPDVDQPCEPSLQAWSPELHLYHMNMTVPCPAEGCSLELLFQHP
VQADTLTLWVTYLSVNSSRALFDIEILLELKESVHLGPLNTFCDTPLTIKLHVDGKVLGV
KVYTLDERMEIDAALLTSRPHSSLCSGCRPVSYQILREPPFSSGLPMVVTHPHRKFTDME
VTPGQMYQYQVQAEAGGELGEASPPLSHIHGGHYCGDGKVARNMGEMCDDGDLLSGDGCS
RACKLEEGFNCVGEPSLCYRYEGDGICEPFEKETSIIDCGLHTPEGHLDQWATQAYSYHE
DKKKCPVSLVTGEPHSMICTSHHPDSSPSPLSLGWFPCAFSLKRAQDEGSEQSEDNLQKD
NEIWLEVCFDRPGVAVALFLFLASDGLAPGEHQRPTVTLYLVDTNGSNHSLGTYELSCHH
NPLVINVSHHANVCPHHTSSMLLNFSSPLVGISAVALRTSSHTSSSAPRNCISEKNHQGH
SCAQRPCGEQEKCTPLILDHADMVNCTSSGPGYMKCSITCQKGYVLQTSSGQYLRTMQKG
ILLTCSSGHWDKDVSCTRLDCGVPDSSLVNYANFSCLEGTDFLKRCSISCVPPAKLQGLS
PWLTCLEDGLWSLPEVYCKLECDAPPVIPNANLLLPHCLEGNHDVGTICKYECKPGYYVM
ESAGIQGRNKFLKIQCLDDGTWEQRSCIPVVCEPPSPVFEGMYECTDGFKLDSQCVLNCN
QETERTPIVCTKEGLWTQEFKLCENLQGECPPPPSELNSVEYKCGQGHGIGAVCSPSCVV
PPSDPVTLPENVTTDTLEHWMEPVKVQSIVCTGRRQWHPDPSLVYCIQSCEPFQADGWCD
TINNRAYCHYDGGDCCSSTLSSKKVIPFAADCDLDECTCRDPKAEENQ
Download sequence
Identical sequences XP_006973872.1.50099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]