SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006982164.1.50099 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006982164.1.50099
Domain Number 1 Region: 217-394
Classification Level Classification E-value
Superfamily MIR domain 9.68e-47
Family MIR domain 0.0024
Further Details:      
 
Domain Number 2 Region: 1081-1208
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-17
Family SPRY domain 0.041
Further Details:      
 
Domain Number 3 Region: 660-811
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000048
Family SPRY domain 0.053
Further Details:      
 
Domain Number 4 Region: 440-552
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000732
Family IP3 receptor type 1 binding core, domain 2 0.012
Further Details:      
 
Domain Number 5 Region: 103-187
Classification Level Classification E-value
Superfamily MIR domain 0.00000955
Family MIR domain 0.028
Further Details:      
 
Domain Number 6 Region: 2185-2255
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000119
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Domain Number 7 Region: 4044-4122
Classification Level Classification E-value
Superfamily EF-hand 0.000035
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006982164.1.50099
Sequence length 4967
Comment PREDICTED: ryanodine receptor 1 [Peromyscus maniculatus bairdii]; AA=GCF_000500345.1; RF=representative genome; TAX=230844; STAX=10042; NAME=Peromyscus maniculatus bairdii; AL=Scaffold; RT=Major
Sequence
MGDGGGEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVP
PDLAICCFVLEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLS
CLTTSRSITDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDLILVSVSSERY
LHLSTASGELQVDASFMQTLWNMNPICSGCEEGFVTGGHVLRLFHGHMDECLTISPSDSD
DQRRLVYYEGGPVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLALTEDQGL
VVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTY
AAPDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIYSTAGLYNQFIKGLD
SFSGKPRGSGPPAGSALPIEGVILSLQDLIGYFEPPSEELQHEEKQTKLRSLRNRQSLFQ
EEGMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRTNCAL
FSTNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKV
LDVLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGSTQY
GKWYFEVMVDEVAPFLTAQATHLRVGWALSEGYSPYPGGGEGWGGNGVGDDLYSYGFDGL
HLWTGHVARPVTSPGQHLLAPEDVVSCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFP
VVSFSAGVKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLQPIKEYRREGPRGPHL
VGPSRCLSHLDFVPCPVDTIQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDD
NKRLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTY
MMSNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNP
RLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQADSQARGDRARIFRAEK
SYAVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPF
GRPWQSGDVVGCMIDLTENNIIFTLNGEVLMSDSGSETAFRDIEIGDGFLPVCSLGPGQV
GHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFEPVPLEHPHYEVAR
MDGTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLASPGLQPPA
EDEARAAEPDPDYENLRRSAGGWGEAEGGKEGTAKEGAPGGTAQAGTEAQPARAENEKDA
TTEKNKKRGFLFKAKKVAMMTQPPTTPALPRLPRDVVPADNRDDPEIILNTTTVLQVVRV
WEGGSESWHSRSVGKETPRVPWWRMYAVTTPVFSSLKCSNCYMVWGGDFVSPGQQGRISH
TDFVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQNVVQFELGKQKN
IMPLSAAMFQSERKNPAPQCPPRLEVQMLMPVSWSRMPNHFLHVDTRRAGERLGWAVQCQ
EPLMMMALHIPEENRCMDILELSERLDLQRFHSHTLALYRSVCALGNNRVAHALCSHVDQ
AQLLHALEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTPETRAITLFPPG
RSAEDGPRRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGAAEAPARLSPAIPLEALRDK
ALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGVFSDEDVKQILKMIEPEV
FTEEEEVEEEEEEEEEDEEEKEEDEEEEAHEKEDEEKEEEEEAAEEGKEELEEGLLQMKL
PESVKLQMCHLLEYFCDQELQHRVESLAAFAECYVDKLQSNQRGRYGLLMKAFTMSAAET
ARRTREFRSPPQEQINMLLQFKNGADEEDCPLPEEVRQDLVNFHQDLLAHCGIQLEGEEE
EPEEETTLGSRLMSLLEKVRLVKKKEEKPEEEPAAEEQKPQSLQELVSHTVVRWAQEDFI
QSPELVRAMFSLLHRQYDGLGELLRALPRAYTISLSSVEDTMSLLECLGQIRSLLIVQMG
PQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTS
CCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQ
EQDLEKVVSYLAGCGLQSCSMLLAKGYPDIGWNPCGGERYLDFLRFAVFVNGESVEENAN
VVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGVRRDRRREHFGEEPP
EENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLDDLVGIIS
LPLQIPTLGKDGALIQPKMSASFVPDHKASIVLFLDRVYGIENQDFLLHVLDVGFLPDMR
AAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSR
GRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERC
WKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDQELYRIAMPCLCAIAGALP
PDYVDASYSSKTEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKI
QNNWSYGENADEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVEKAREGEE
EKTEKKKTRKISQTAQTYDPREGYNPQPPDLSGVTLSRELQAMAEQLAENYHNTWGRKKK
QELEAKGGGSHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDTSSI
EKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFT
NHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTDAPAVVNCLHIL
ARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLTY
TTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTRNPYVEKLRPALG
ECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMCPDIPVLERLMA
EIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPPALPAGAPPPCTAVTSDH
LNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLRSHFIPTIGRLRKRAGK
VVAEEEQLRLEAKAEAEEGELLVRDEFSVLCRDLYALYPLLIRYVDNNRAHWLTEPNPNA
EELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKAGDVQSGGSDQ
ERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLIVLAKARYALKDTDEEVRE
FLQNNLNLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYHLDQTEH
PYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKASWILTEDHSFED
RMIDDLSKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDEDYLYMAYADIMAK
SCHLEEGGENGEEGEEEGSEVSFEEKEMEKQRLLYQQSRLHNRGAAEMVLQMISACKGET
GAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQ
NKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNT
TTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLTEYIQ
GPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSL
LEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAFQDYITDPRGLISK
KDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGFNVAVLLTNL
SEHVPHDPRLRNFLELAESILEYFRPYLGRIEIMGSSRRIERIYFEISETNRAQWEMPQV
KESKRQFIFDVVNEGGESEKMELFVSFCEDTIFEMQIAAQISEPEGEPEQDEDEGAEEAE
EGAAGPDGTGVAAAAGGAGAAAGALRLLWGSLFGGGLVDSAKKVTVTELLAGMPDPTGDE
VHGQQPSGPGSDAEGEGEGEGEGDAAEGAGDEEAAADQAGTGGADGAVAVADGSPFRPEG
TGGLGDMGDTTPVEPPTPEGSPILKRKLGVDGEEEEPPPEPEPEPEPEKADTENGEKEEV
PEPPPEPPKKTPPPPPPKKEEAGGAGLEEFWGELEVQRVKFLNYLSRNFYTLRFLALFLA
FAINFILLFYKVSDSPPGEDDVEGSGAGDMSGAGSGGGSGWGSGASEEVEGDEDENMVYY
FLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELARKLEFDGLYITE
QPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIFGRERIAELLGMDLASLEI
TVHNERKPDPPPGLLTWIMSIDVKYQIWKFGVIFTDNSFLYLGWYMVMSLLGHYNNFFFA
AHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDED
EPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLA
IIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMF
FLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS
Download sequence
Identical sequences XP_006982164.1.50099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]