SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006985069.2.50099 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006985069.2.50099
Domain Number 1 Region: 30-143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 238-355
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000275
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 441-478
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 151-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 5 Region: 197-236
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000111
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 402-439
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_006985069.2.50099
Sequence length 757
Comment PREDICTED: low-density lipoprotein receptor-related protein 3, partial [Peromyscus maniculatus bairdii]; AA=GCF_000500345.1; RF=representative genome; TAX=230844; STAX=10042; NAME=Peromyscus maniculatus bairdii; AL=Scaffold; RT=Major
Sequence
GARAPLAVVCLVNLFLTGRLSSAVPALAACSGKLEQHTERRGVIYSPAWPLNYPPGTNCS
WYIQGDRGDMITISFRNFDVEESHQCSLDWLLLGPAAPPRQEAFRLCGSAIPPAFISARD
HVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQTDEFRCDNGKCLPGPWQCNLVDECGD
GSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPVERRCDGTQDCGDGSDEAGCPDLA
CGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLELRLGYDDYVQVYEG
LGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQ
PCGGSSEGDDGSTGEQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPCEGGSGLCYAP
ADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDGSDEHGCLAAV
PRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEAEFVRREAPPSY
GQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRRRLGRLWNRLFH
RPRAPRGQIPLLTAARTSQTVLGDGLLQAAPGSVPDPPAPHTDTGSPREAGDGPPSGPGH
VPEVGPSVPPPPLNLRDPEYRPEDKERKACEDPPEDSPAPVDTPPEPCLAQDPYPQTPTA
SSTQDPHSPESLGVCRSPPPTCSPILEASDDEALLVC
Download sequence
Identical sequences XP_006985069.2.50099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]