SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_006998450.2.50099 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_006998450.2.50099
Domain Number 1 Region: 211-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 267-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.87e-24
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 155-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 351-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.69e-22
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 5 Region: 16-74
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-21
Family KRAB domain (Kruppel-associated box) 0.0002
Further Details:      
 
Domain Number 6 Region: 435-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 537-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.22e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 492-548
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.71e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 314-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000413
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 10 Region: 113-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000151
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 398-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000348
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 76-128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000673
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_006998450.2.50099
Sequence length 597
Comment PREDICTED: zinc finger protein 431-like isoform X2 [Peromyscus maniculatus bairdii]; AA=GCF_000500345.1; RF=representative genome; TAX=230844; STAX=10042; NAME=Peromyscus maniculatus bairdii; AL=Scaffold; RT=Major
Sequence
MVSKGLLFPDREEWPAMTAVTYDDVHIDFTWEEWTLMDPSQKNLYKDVMWETYRNLTAVG
YSWEDHDIEEHCQSSGKLRRYKEHHIGEKPSEYTQCAKAFLYYGHLQNNESIHTGEKLYS
CIQYDEAFSHNSSLQIREETHTGKKISKSNQCGKAFTSHDHFQIHKGTHTGEKPYECNQC
GKAFACSSRLQRHERRHTGEKPYECNQCGKAFACTSNLQRHERTHTGERPYKCNQCDKAF
SQHSYLQMHERTHTGEKPYKCNQCNKAFLRPSRLQIHERMHSGEKPYKCNQCDKAFACAS
TLQIHERTHTGEKPYKCNQCDKAFLRHTQLQIHERIHSGEKPYKCNQCDQAFACSSSLRK
HERTHSGEKPYKCNHCDQAFAYSSSLRKHEITHSGVKPYKCNQCDKAFSGHSLLQRHETT
HSGEKPYKCSQCNKAFSQYSRLRIHERTHSGVKPYKCSQCHKNFSRHHLLQMHERTHSGE
KPYKCNQCDKGFACVDSFQIHERKHTGEKPYKCNQCNKAFLQHFHLQIHEITHSVEKPHE
CNQCGKGFACSSSLRRHERTHIGEKPYKCNQCDKAFSRHSYLQRHERTHYWRDILQM
Download sequence
Identical sequences XP_006998450.2.50099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]