SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007046884.2.67643 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007046884.2.67643
Domain Number 1 Region: 31-210
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.06e-65
Family Inorganic pyrophosphatase 0.00000497
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007046884.2.67643
Sequence length 215
Comment PREDICTED: soluble inorganic pyrophosphatase [Theobroma cacao]; AA=GCF_000208745.1; RF=representative genome; TAX=3641; STAX=3641; NAME=Theobroma cacao; cultivar=B97-61/B2; AL=Chromosome; RT=Major
Sequence
MTNNGGEATSGKNAGFPRVALNERILSSMTRRSVAAHPWHDLEIGPGAPAVFNCVVEIGK
GSKVKYELDKASGLIKVDRVLYSSVVYPHNYGFIPRTICEDSDPMDVLILMQEPVLPGSF
LRARAIGLMPMIDQGEKDDKIIAVCADDPEFRHYTDIKHLPPHRLAEIRRFFEEYKKNEN
KHVDVENFLPAETAIQAIKYSMDLYASYIVESLRK
Download sequence
Identical sequences XP_007046883.2.67643 XP_007046884.2.67643 Tc01_g002950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]