SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007063718.1.26238 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007063718.1.26238
Domain Number 1 Region: 320-532
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.3e-31
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 2 Region: 768-971
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.74e-26
Family Laminin G-like module 0.0086
Further Details:      
 
Domain Number 3 Region: 545-723
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.11e-25
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 4 Region: 6-124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000151
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 1154-1194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000257
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 6 Region: 161-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000977
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 7 Region: 998-1039
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000175
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 120-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000182
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 9 Region: 1072-1109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000031
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 1034-1076
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1125-1159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000025
Family EGF-type module 0.015
Further Details:      
 
Domain Number 12 Region: 254-297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000398
Family EGF-type module 0.005
Further Details:      
 
Domain Number 13 Region: 233-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000529
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007063718.1.26238
Sequence length 1264
Comment PREDICTED: protein crumbs homolog 1 [Chelonia mydas]; AA=GCF_000344595.1; RF=representative genome; TAX=8469; STAX=8469; NAME=Chelonia mydas; AL=Scaffold; RT=Major
Sequence
MLCETYFNVCISNPCHNGALCREGIDGYSCYCVPGYQGKHCDLEVNECDSDPCLNGATCL
NQIGKYDCICPAEYMGINCELEIDECLSQPCLNGATCHDTLGSYFCSCALGFLGELCEIN
IDECASQPCLNGGQCIDDINRYSCNCTSSGFTGLNCEILISLCQSQPCHNNATCEDSAEN
YTCHCWPGYAGSHCEIDVNECSSNPCFYESECVERSWTTWYGRILELPADFSYNRASGYV
CNCRPGFTGIHCEEDINECYMNPCQNGGTCENFPGNYTCHCPFGEKEGISFGGRNCTEVL
LGCNNHQCQNNGLCIPHLKNGHHGSSCICPPGYTGTHCETITTFSFEGNGFLWVNSDMTA
VQGSFYNINLRFQTVQPTAFIFHRGKKDTFVTLELLNGYLRLFVQVNNQPQVLLHISHNV
SDGEWHSVEVTLARAVTLNLLDSSCIESCVNKSTAAIDSDQLTLAFQSIFLGGLREGNMS
SDSPPNIYNMHSAPSFVGCLQDIEIDLNIITPENISSETSLNVKSGCTKQDRCENHPCQN
RGRCINLWLSYQCDCYRPYTGPNCSTEYMPGRFGREDSSGYAAFSVDAGQNENLTISMFV
RTRKSSGLLLAVRNSTSLYIRIWLEDGKLVMLASNSTKLFGTWTVSDGNFYLISLKIQPN
KAELFQSSLQLGYISTPILTVQSRDILYIGGLPDKQETDINGGYFKGCIQDLRLNNQQLE
FFPITTSLYSVINRTLINVTQGCTGDNLCKSNPCHNGGICYSIWDDFTCTCPPNTAGKAC
EEVKWCELSPCPHEAQCQLVHQGFECVANAVFSGRSSAIFYRTNGKIRRDLTNIVFGFRT
RDADVILLYAEKEPEFITIRIQNTRLVFQLQSGNGFYVLTLASSQPVNDGKWHQVILSMT
EPLSQSSRWHIDIDDKKDTATSTVATGSLNFLREEIDIYVADKAFDNLDGLRGCMSTIEI
SGIYLSYIENYDGHTKKPQEEQFLKISANSVVTGCLQLDACSSDPCMHDGICEDLYSYYR
CTCPKGWTGMHCETSIDECFSNPCIHGNCLDRIASYECRCDPGYTGVNCEEDIDNCRGHL
CANGATCIDGVNTYSCLCAGNFTGKFCRHIRLPFSVCGNEKRNLTCYNYGNCTELKGELR
CVCLPGFSGERCETDIDECNSDPCMNGGLCQNLLNKYQCICDVNYAGDHCEVDLTADLIS
NIFTAIGSVTLALLLILFLAIVISVIAANKRATQGTYSPSRQEKEGSRVEMWNMVQPPPI
ERLI
Download sequence
Identical sequences XP_007063718.1.26238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]