SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007082051.1.5354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007082051.1.5354
Domain Number 1 Region: 2142-2235
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-32
Family Link domain 0.00011
Further Details:      
 
Domain Number 2 Region: 509-647
Classification Level Classification E-value
Superfamily FAS1 domain 1.44e-28
Family FAS1 domain 0.0021
Further Details:      
 
Domain Number 3 Region: 1710-1864
Classification Level Classification E-value
Superfamily FAS1 domain 1.14e-25
Family FAS1 domain 0.0059
Further Details:      
 
Domain Number 4 Region: 965-1122
Classification Level Classification E-value
Superfamily FAS1 domain 9.29e-23
Family FAS1 domain 0.0045
Further Details:      
 
Domain Number 5 Region: 1473-1521,1599-1709
Classification Level Classification E-value
Superfamily FAS1 domain 8.24e-22
Family FAS1 domain 0.0058
Further Details:      
 
Domain Number 6 Region: 386-501
Classification Level Classification E-value
Superfamily FAS1 domain 6.93e-21
Family FAS1 domain 0.0054
Further Details:      
 
Domain Number 7 Region: 2233-2395
Classification Level Classification E-value
Superfamily FAS1 domain 8.37e-17
Family FAS1 domain 0.0069
Further Details:      
 
Domain Number 8 Region: 1130-1254
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000126
Family FAS1 domain 0.0086
Further Details:      
 
Domain Number 9 Region: 1545-1582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000897
Family Merozoite surface protein 1 (MSP-1) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007082051.1.5354
Sequence length 2505
Comment PREDICTED: stabilin-1 [Panthera tigris altaica]; AA=GCF_000464555.1; RF=representative genome; TAX=74533; STAX=9694; NAME=Panthera tigris altaica; AL=Scaffold; RT=Major
Sequence
MAGPRGLLLLCLLAFCLAGSSFTRGQKVRSRRCDVKTKFVMRIPCTMCPTIKRRMCPPGW
LRELPEKISQDCRYEVQLGDSLMSMSGCSMECWKDVVEKACCPGYWGSQCYECPGGAETP
CNGRGTCLDGIDGNGTCVCQENFSGSPCPECQDPSRLGPNCQAVCSCVHGVCNHGPLGDG
SCLCFAGYTGPRCDQELPVCQALNCPQNSQCSAEAPACSCLPGHTQQGRECRAPNPCQPS
PCSPLAQCSVSPTGQAQCRCPKDYHGDGTVCLPHDPCTINHGGCPINSTVCLYLRSGKAS
CQCKPGLVSINHNASAGCFAYCFPHSCDRSATCQVTSDGKTSCVCKEGEVGDGRACYGHL
LHEIQKASQLGVVFLRLRVTLAMLDQGCREILTTSGPFTVLVPSLSSVFSRTMNASVARQ
LCKQHIVAGQHILEELGTQQTRRWWTLDGQELTVTFNHFMKYTYKYKEHPQQTFTIQKAN
YPAANGVFHLVTALQWQPPPELPEDPKRTIGQILASTEAFSRFETILENCGLPSILDGPG
PFTVFVPSNEAVDMLRDGRLIYLFTAGLSKLQELVKYHIYSHGQLTIEKLISKGRVLTMA
NQVLAVNISEEGRILLGPEGVPLRRVDVLAANGVIHMLEGVLLPPTILPILPKHCNEEQY
KIVAGSCVDCQALNTSMCPPNSMKLDIFPKECVYTHDPTGLNVLKKGCAHYCNQTILKPG
CCKGFFGPDCIQCPGGFSNPCYGKGTCSDGVRGNGACLCFPDYKGIACHICSNPNKHGDR
CQEDCGCVHGLCDNRPGSGGVCQRGTCAPGFSGHFCNESSVNCGPTERAQSCHLHARCVS
QGGVTRCVCLDGFEGDGFSCTPSNPCSHPDRGGCSENAECVPGALGNHHCTCHKGWSGDG
RVCVAIDECELDVRGGCHADALCSYVGPGQSRCTCKLGFAGDGYVCSPIDPCRAGNGGCH
DLATCQAVGGGQRVCTCPSGYGGDGFNCYGDIFRELEANAHFSVFYQWIKSAGITLPTDS
RVTALVPSESAIRRLSPEDQAFWLQPRMLPHLVRAHFLQGALSEEELARLAGQDVATLSP
TTRWEIHNISGRVWVQNASVDVADLLATNGVLHVLSQVLLPPRGDALHGQGLLQQLDSVP
AFHLFRELLQHHRLVPQIEAATAYTIFVPTNRSLEAQGNSSILDADTVRHHVILGEALST
ESLQKGGHRNSLLGPAHWLVFYNHSGQPEVNHMPLEGPVLEAPGRSLFGLSGVLTVGSSR
CLHSHAESLREKCINCTRKFRCTQGFQLENTPRKSCVYRSGYSFSRGCSYTCAKKIQVPD
CCPGFFGTLCEPCPGGLGGVCSGHGQCQDRLLGSGECHCHEGFHGTACEMCELGRYGPTC
AGVCDCAHGLCQEGLQGDGSCVCHAGWQGPRCDQKISGPQCPKKCDPNANCVQDSATAPA
CVCAAGYSGDGVHCSEVDPCARDHGGCSPHANCTKVAPGQRTCTCQDGYTGDGELCQEVN
SCLIHHGGCHMHAECIPTGPQQVSCSCREGYSGDGIRTCELLDPCSQSNGGCSPYAVCKS
TGDGQRTCTCDAAHTVGDGFTCRARVGLELLRDRHASFFSLHLLEYKELKGDGPFTVFVP
RADLMSNLSQAAIRGLPLPSRTPTPGCRQLRSQELLDEGYVTTLSGHTLRIHEREGSIYL
NDFARVVSSDHEAVNGVLHFIDQVLLPPDVLYWKPDVAPVLRRNVTAAAESFGYKIFSGL
VKVAGLLPLLQDAAHRPLTMLWPTDSALQALPPDRQAWLYHEDHRDKLAAILRGHVIRNI
EALASDLPNLGPLRTMHGTPISFSCSRVRPGELTVGEEDARIMQRHLPFEGGLAYGIDQL
LEPPGLGARCDRFETRPLRLKICSICGLEPPCPEGSREQGSPETCWRYYSKFWTSPPLHS
LALRSIWARSSLWGQPQGLGRGCHRNCVTTTWKPSCCPGHYGSECRACPGGASSPCGGHG
VCMDGMSGSGQCQCHSRFTGTACELCASGAFGPQCQACRCTSHGRCDEGLGGSGSCFCDE
GWTGPSCEVQLSECCLCLCPPECFYMLACSGVCPDHTLRWKHLPALPPQNTRRCVCHAGY
VGDGLQCLEEPEPPVDRCLGQPPPCHVDAVCTDLHFQEKQAGVFHLQAPSGPYGLNFSEA
EAACGAQGAVLASLPQLSAAQKLGFHLCRVGWLANGSAAHPVVFPAADCGGGQVGVISLG
LRKNHSERWDTYCYREQDVACRCRQGFVGDGTSVCNGKLLDVLAATANFSTFYGMLLGYA
NATPRGLDFLDFLDDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNTTFLSTNASQDTV
LPAHSGLSLFFSAVGPDNNSWVPVAPGAVVVSHVVVWDIMAFNGIIHALARPLLAPLQPQ
AVVAPEGPPVVAGVGAVVAAGALLGLVAGAFYLRARGQATGFGFSTFQAEDDAEDDFSPW
QEGTSPTLVSVPNPVFGSPDAFCEPFDDSLLEEDFPDTQRILTVK
Download sequence
Identical sequences XP_007082051.1.5354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]