SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007116650.1.24612 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007116650.1.24612
Domain Number 1 Region: 2206-2300
Classification Level Classification E-value
Superfamily C-type lectin-like 4e-31
Family Link domain 0.00014
Further Details:      
 
Domain Number 2 Region: 506-644
Classification Level Classification E-value
Superfamily FAS1 domain 1.83e-28
Family FAS1 domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1470-1518,1596-1710
Classification Level Classification E-value
Superfamily FAS1 domain 3.53e-27
Family FAS1 domain 0.0024
Further Details:      
 
Domain Number 4 Region: 1712-1865
Classification Level Classification E-value
Superfamily FAS1 domain 2.88e-24
Family FAS1 domain 0.0049
Further Details:      
 
Domain Number 5 Region: 962-1119
Classification Level Classification E-value
Superfamily FAS1 domain 1.44e-23
Family FAS1 domain 0.0038
Further Details:      
 
Domain Number 6 Region: 386-498
Classification Level Classification E-value
Superfamily FAS1 domain 3.53e-19
Family FAS1 domain 0.0032
Further Details:      
 
Domain Number 7 Region: 2297-2460
Classification Level Classification E-value
Superfamily FAS1 domain 8.5e-17
Family FAS1 domain 0.0082
Further Details:      
 
Domain Number 8 Region: 1128-1252
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000301
Family FAS1 domain 0.0067
Further Details:      
 
Domain Number 9 Region: 1542-1579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000167
Family Merozoite surface protein 1 (MSP-1) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007116650.1.24612
Sequence length 2569
Comment PREDICTED: stabilin-1 [Physeter catodon]; AA=GCF_000472045.1; RF=representative genome; TAX=9755; STAX=9755; NAME=Physeter catodon; AL=Scaffold; RT=Major
Sequence
MAGPRDHLLLCLLALCLAGSSFIGGQKVQSRRCDVKTKFVTHIPCTPCPAIKKRVCPSGW
LREFPEKISQDCRYEVQLGDSLLSVSGCSLECSKDVVQKACCPGYWGSQCYECPGGAETP
CNSHGTCLDGIDRNGTCVCQENFSGSACQECRDPNRFGPDCQSVCSCVHGVCRHGPLGDG
SCLCFAGFTGPHCDQELPVCQALNCPQNSQCSAEAPTCSCLPGHTQQGGECLAPDPCQPS
PCSPVAQCSVSPRGQAQCRCPENYHGDGTVCLPQDPCTTNNGGCPSNSTLCLYKRPGQAF
CSCKPGLVSTNHNASAGCFAYCFPYSCDRSATCQVTPDGKTSCVCKEGEVGDGRACYGHL
LHEVQKASQTSMTLLRLRVAFAMLDQGCREILTTSGPFTVLAPSISSRTMNASLAQHLCR
QHIIAGQHMLEESGIQPTRRWWTLAGQEITVTFSRFRKYTYKYKDQPQQTFTIHKANYPA
ANGIFHVVTALRWQPPPELPEDPKRTIGQILASTEAFTRFETILENCGLPSFLDGPGPFT
VFAPSNEAVDGLRDGRLVYLFTAGLSKLQELVRYHVYSHGQLTVEKLISKGRVLTMANQV
LAVNISEEGRILLGPEGVPLRRVDVLAANGVIHMLEGILLPPTILPILPKLCNEEQHKVV
AGSCVDCQALNTSMCPHNSVKLDISPEECVYIHDPTGLNVLKKGCAHYCNQTILKPGCCK
GFFGPDCVQCPGGFSNPCYGKGNCSDGVQGSGACLCFPDYKGIACHICSNPNKHGEQCRE
DCGCVHGLCDNRPGSGGVCQRGTCAPGFSGRFCNESTGNCGPTEQAQQCHPHARCVNQGD
VARCLCLDGFEGDGFSCTPSNPCSRPDRGGCSENAECVPGAPGTHHCTCHKGWSGDGRVC
VAIDECELDVRGGCHADALCSYVGPGQSQCACKLGFAGDGYMCSPIDPCRAGNGGCHDLA
TCRAVGGGQRVCTCPPGYGGDGFSCYGDIFQELEANAHFSIFYQWIKGAGITLPANSRVT
ALVPSESAIRRLSPEDQAFWLQPRMLPQLVRAHFLQGALSEEELARLDGQSVATLSPTAR
WEIHNISGRVWVQNASVDVADLLATNGVLHVLSQVLLPPRGDVLGGQGLLQQLDSVPAFR
LFRELLQRHRLVPQIEAATAYTIFVPTNHSLEAQANSSSLDLDVVRHHVILGEALSTEAL
RRGGHRNSLLGPAHWLVFYNHSGQPEVNHVPLEGPVLEAPGRSLFGLSGVLMVGSSRCLH
SHAEALREKCVNCTRKFRCTQGYQLEDTPKKSCVYRSGYSFFRGCSYTCAKKIQVPDCCP
GFFGTLCEPCPGGLGGVCSGHGQCQDRLLGSGECRCHEGFHGTACEMCELGRYGPNCTGV
CDCAHGLCQDGLRGDGSCVCNVGWQGLRCDQKITGPQCPQKCDPNANCVQDSAAAPACVC
AAGYSGDGIYCAVVDPCAHDHGGCSPHANCTNVAPGQRTCTCLDGYTGDGELCQEVNSCL
IHHGGCHMHAECIPTGPQQVSCSCREGYSGDGIRTCVLLDPCSQNNGGCSPYAVCKSTGD
GQRMCTCDAVHTVGDGFTCRARVGLELLREKHASFFSLHLLEYKELKGDGPFTIFVPHAD
LMTNLSQDELARIRANRQLVFRYHVVGCRQLRSQELLEEGYATTLSGHPLRFSEREGSIY
INDFARMVSSDHEAVNGVLHFIDRVLLPPEALHWEPDAAPILRRNFTAAAESFGYKIFSG
LVTMAGLLPLLRDSFHRPFTMLWPTDSALQALPPDRQVWLYHKDHRDKLAAILRGHVIRN
VEALASDLPNLGPLRTMHGTPISFSCSRARPGELTVGEEDARIVQRHLPFEGGLAYGIDQ
LLEPPGLGARCDRFETRPLWLKVCSICGLEPPCPEGSQEQGSPEACWRYFSKFWTSPPLH
SLALRSVWARPSHWGQPQGLGRGCYRNCVTTTWKPSCCPGHYGSECRACPGGASSPCNGH
GTCMDGMSGRGDCRCRSRFAGMACELCAPGAFGPLCQACNCTSHGHCDEGLGGTGYCFCD
EGWTGPHCEVQLELQPVCAPPCASQAVCRAGHSCECSLGYEGDGRTCTVVDLCQDGRGGC
SEHANCSQVGTVVTCTCLPDYEGDGWSCRARNPCEDGHRGGCSEHADCLSTGPNTRRCAC
HAGYVGDGLQCLEEPEPPVDRCLDQPPPCHVDAVCTDLHFQEKRAGVFHLQAPSGPYSLN
FSQAEAACGAQGAVLASLPQLSAAQQLGLHLCLVGWLANGSAAHPVVFPAADCGDGQVGV
VSLGARENLSERWDAYCYRMQDVACRCRDGFVGDGASVCNGKLLDVLATTANFSTFYGML
LGYANATPRGLDFLDFLDDELTYKTLFVPVNEGFMDNLTLSGPDLELHASNTTFLSTNAS
QGTLLPAHSGLSLIISDMGPDNSSRAPVVPGAVVVGHVIVWDIVAFNGIIHTLASPLLAP
PQPRAAVAPEAPPVAAGAGAVVAAGVLLGLAAGVLYLRARSRSTGFGFSAFQVEDDAADD
FSPWQEGTSPTLVSVPNPVFGSHDAFCEPFDDSLLEDDFPDTQRILEVK
Download sequence
Identical sequences XP_007116650.1.24612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]