SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007146893.1.22112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007146893.1.22112
Domain Number 1 Region: 337-438
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-20
Family B3 DNA binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007146893.1.22112
Sequence length 911
Comment hypothetical protein PHAVU_006G079300g [Phaseolus vulgaris]; AA=GCF_000499845.1; RF=representative genome; TAX=3885; STAX=3885; NAME=Phaseolus vulgaris; cultivar=G19833; AL=Chromosome; RT=Major
Sequence
MGSDICVVNGSCTHEWRKGWPLRSGGFAQLCCKCGFMEEWKGDILEPLSTYENSVFCSKF
HHQQTGWRECNFCNKPIHCGCMVSRSLFEHLDYGGIGCVSCVNTSQLSTMRNIENPNGPV
SLIKNNASDRPSSHSEGRLFARGVDEGKLMQFCKIIEASESSRWNNAQRDGIISRHGHNN
QEAKCSFGEGDIGFSNVMKPSVQSLTFATLENNRSPWEIKNIHEANVQPSLSMYLGNASG
NNSVLPSAGEAVEGRLEGKPSPPFHQGQRSRPIFPKPLKSGLTMNVEIDKGTISQSRVAR
PPADGRGKNQLLPRYWPRITDQELERLSGDLKSTVVPLFEKVLSASDAGRIGRLVLPKAC
AEAYFPSISQSEGVPLRMQDVKGNEWTFQFRFWPNNNSRMYVLEGVTPCIQAMQLRAGDT
VTFSRIDPGGKLVMGFRRASNSADTQDTSTSAQSNSAKGTTSAGTENLPSGSSHANLLLS
MKGGNVEPHLNGQREHLHLGTGTSELLITENNGMTNNSSVQQKFLSLEKKKTRNIGPKSK
RLLIDNEDARELKLTWEEAQDLLRPPPSVKPSIVTIEDQVFEEYDEPPVFGKRTIFSTCS
SGVKEQWAQCDDCSKWRKVPIDALLPANWTCFDNAWDSIRCSCTVPEELSSGELENLLKT
DKDFKKRRSDEKSKSIQEHEASGLEALACAAALGENLVDTAESSAGATTKHPRHRPGCSC
IVCIQPPSGKGRHKPTCTCNVCLTVKRRFKTLMLRKKKRQSEREAEAAQKDQVLQKEESD
TNETSRDDATQLEKEVVGLSRSQAEGGESSAAGQIDLNSHPNREDMQVDITGVMFCETDP
STVREYMNQNGPRSYNNELQNGENSSLHTSQSNVEGQRHFSDLRSFASIMWNQERRDEED
SEPNQSQNNLC
Download sequence
Identical sequences V7BLQ5
XP_007146893.1.22112 XP_007146894.1.22112 Phvulv091029828m|PACid:23556109 Phvulv091029829m|PACid:23556110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]