SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007170182.1.59432 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007170182.1.59432
Domain Number 1 Region: 242-497
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.42e-64
Family Eukaryotic proteases 0.000000225
Further Details:      
 
Domain Number 2 Region: 62-177
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.15e-22
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 3 Region: 203-251
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000266
Family Complement control module/SCR domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007170182.1.59432
Sequence length 523
Comment PREDICTED: complement C1r subcomponent-like protein [Balaenoptera acutorostrata scammoni]; AA=GCF_000493695.1; RF=representative genome; TAX=310752; STAX=9767; NAME=Balaenoptera acutorostrata scammoni; AL=Scaffold; RT=Major
Sequence
MPGLRVGELSLGKPHSTRCPGNTLQATAMWSHLPPPTPRWWLLLWGVLQACPTHGCVLLA
QPLPQKLTSPGYPEPYVKGQESSTDIEAPEGFAVRLVFQDFDLEPSPDCVRDSVTITASG
MDPSRFCGQQGSLLGSPPGQREFVSSGNSLRLTFRAPASEDRTPGLHKGFLALYQAVGVN
HSQPISQASGDPEAINTPGDNSTEIQSHCQQPYYQAVPAGTLTCTAQVPWKQTQEREEVP
RCVPVCGRPVIPIAQNREPAGASRAELGNFPWQALTSIYGRGGGALLGDRWILTAAHTIY
PKDGVFLGKSRRAQVFLGHTDIDELLELGGHPVRRVVVHPDYRPDQTHNFHGDIALLELR
HRVPLGPHLLPVCLPDRKALYRPGLAGYVSGFGVENGWLTTELKYSRLPVAPRAACEAWL
RAKRRTEVFSGGMFCAGDSTRPQRVCQGDSGGAYVVWDDRARRWVATGIVSWGIGCGEGY
GFYTKVLNYVDWIRGVMDGKDDPGVLSRGAHRGAQMGEGWVQD
Download sequence
Identical sequences XP_007170182.1.59432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]