SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007175964.1.59432 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007175964.1.59432
Domain Number 1 Region: 529-748
Classification Level Classification E-value
Superfamily Bet v1-like 3.98e-40
Family STAR domain 0.0057
Further Details:      
 
Domain Number 2 Region: 87-248
Classification Level Classification E-value
Superfamily PH domain-like 1.16e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007175964.1.59432
Sequence length 757
Comment PREDICTED: collagen type IV alpha-3-binding protein isoform X3 [Balaenoptera acutorostrata scammoni]; AA=GCF_000493695.1; RF=representative genome; TAX=310752; STAX=9767; NAME=Balaenoptera acutorostrata scammoni; AL=Scaffold; RT=Major
Sequence
MQHSGVPIPPSPFSAPPPFLPGVTREGRRGLSSGGSAGQSAGVTGTATTAAAADGWKGRL
PSPLVLLPRSARCQARRRRRRGGRTSSLLQLPPAPERALLPSPSSDPSPRGLGASAGAAQ
GAGAGLLLGCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVL
KNNTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQ
WIDAIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETF
RDILCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKV
FPHVTPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKESEKRRRI
EEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRL
HWPTSMPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTY
SLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDV
RNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSAIRKIPALTENDPETWI
VCNFSVDHNSAPLNNRCVRAKINIAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGG
WAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences XP_007175964.1.59432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]