SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007180385.1.59432 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007180385.1.59432
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000417
Further Details:      
 
Domain Number 2 Region: 242-362
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 3.14e-28
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000184
Further Details:      
 
Domain Number 3 Region: 382-442
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000876
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007180385.1.59432
Sequence length 454
Comment PREDICTED: wiskott-Aldrich syndrome protein [Balaenoptera acutorostrata scammoni]; AA=GCF_000493695.1; RF=representative genome; TAX=310752; STAX=9767; NAME=Balaenoptera acutorostrata scammoni; AL=Scaffold; RT=Major
Sequence
MSGGPSGGRPGGRGGPGVQENIPSTLLQDHENQRLFEMLGRKCWTLATAVVQLYLALPRG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGD
DCQAGLNFADEGEARAFRTLVQEKIQKRNQRQGGDRRQLPPPPVPANEERRGGLPPLPPE
PGGDQGGPAAGSLSLGLVTVDIQNPDITNSRYRGLPAPGPGPGDKKRSGKKKISKADIGA
PSGFKHVSHVVWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKFIYDFIENQGGL
EAVRKEMRRQEPLPPPPPPSRGGNQPPRPPAVGSNKGRPAGGPPLPPPPPPPPPPPSSGD
GPIAPPPPPSLGLVGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVG
ALMHVMQKRSRASHSSDEGEDQAGDDDEDDEWDD
Download sequence
Identical sequences XP_007180385.1.59432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]