SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007205732.1.23749 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007205732.1.23749
Domain Number 1 Region: 76-190
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000549
Family Glutathione peroxidase-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007205732.1.23749
Sequence length 265
Comment thioredoxin-like protein AAED1, chloroplastic [Prunus persica]; AA=GCF_000346465.2; RF=representative genome; TAX=3760; STAX=3760; NAME=Prunus persica; cultivar=Lovell; AL=Chromosome; RT=Major
Sequence
MALISPQILTLKSPSTPSLPSHSSLIAPSQSPSFSPPNTPRSPSLFCSPKSTTQYSSRRL
VVSRASTNASALDFSPSIGEVLGDVSIFTAAGDSVQFKDLWDLNEGVAVVALLRHFGCPC
CWELASALKESKARFDSAGVKIIAVGVGSPDKARILAERLPFPMDSLYADPDRKAYNVLG
LYYGLGRTFFNPASAKVFSRFEALQKAVKNYTIEATPDDRSSVLQQGGMFVFKGKQLLYA
RKDEGTGDHAPLDDILDVCCKVPVS
Download sequence
Identical sequences M5W0P5
XP_007205732.1.23749 ppa010087m|PACid:17654882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]