SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007212831.1.23749 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007212831.1.23749
Domain Number 1 Region: 230-319
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.64e-19
Family Thioltransferase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007212831.1.23749
Sequence length 376
Comment uncharacterized protein At3g28850 [Prunus persica]; AA=GCF_000346465.2; RF=representative genome; TAX=3760; STAX=3760; NAME=Prunus persica; cultivar=Lovell; AL=Chromosome; RT=Major
Sequence
MKGVKGKFLKKLKSIRPVGYLKPQDRILQVSASDGYADSYPKISDLNVQAQLVSMETEQK
KMKENVLTEQEPDVIDVDELMKDLEDEESGSEDDLDDKENIRPKMKAKNSMAFKENLMRT
EHNLGENRALEASEESLPGPDRGRQIPLSEIDISSFRRPDLNSGSLFDPNLLAAFQQAVM
EYMKLSEAERISRRSEKQNLDSNVVEPEPEPPSNEEPLLCFEEKCVPGSSDSSVILYSTT
LRGIRKTFDDCNSVRFLLESFRVVFYERDVSMHMEFREELWQVLDCKAVPPKLFIKGRYI
GGAEEVLTLHEQGKLKPLFHGVPIDRSIGPCEACDGVRFVVCFKCSGSCKVIGQEGQSDK
CSVCNENGLIICPLCC
Download sequence
Identical sequences M5X4M6
XP_007212831.1.23749 ppa020739m|PACid:17667996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]