SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007214296.1.23749 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007214296.1.23749
Domain Number 1 Region: 80-157
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.68e-18
Family Thioltransferase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007214296.1.23749
Sequence length 176
Comment monothiol glutaredoxin-S17 [Prunus persica]; AA=GCF_000346465.2; RF=representative genome; TAX=3760; STAX=3760; NAME=Prunus persica; cultivar=Lovell; AL=Chromosome; RT=Major
Sequence
MGGSVKVSQSKKVVWPSSCEASKHMDEDGKVADTLEGADPSSLANKVAVEPEEPAPELTK
ENESSQEQIQVQDGLDDALKRRLQQLIESNRVMLFMKGTPEDPKCEFSKMAVNMLKIYEV
EFGSFDLLTDNEVMEGIQKYSNWPLLPHIYFEGRACGFRHIGTLMKGCPSDPTAFG
Download sequence
Identical sequences M5X8W1
ppb013122m|PACid:17641992 XP_007214296.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]