SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007218804.1.23749 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007218804.1.23749
Domain Number 1 Region: 125-217
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.45e-23
Family Thioltransferase 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007218804.1.23749
Sequence length 275
Comment uncharacterized protein At5g39865 [Prunus persica]; AA=GCF_000346465.2; RF=representative genome; TAX=3760; STAX=3760; NAME=Prunus persica; cultivar=Lovell; AL=Chromosome; RT=Major
Sequence
MADLENRLELSGKPKPTALFFNRSLSMYPTPMDAPKKPHFHASLDHHTNSFKKFYNSIET
VRSASSSFKGKVKKLCSFFESDKPGSRNPDESQSLMNVKLRPSKSMAPSKSIAPDFRILS
IRLPGTDDRIVVYFTSLRGIRRTYEDCYAVRMIFKGFGVWVDERDISMDSAYRKELQSVL
GEKNVSLPQVFIRGKYVGGAEVIKQLFETGELAKILQGIPIRKPGFVCEGCGDARFVPCM
NCSGSRKVFDEDEGMLKRCPECNENGLTRCRDCSS
Download sequence
Identical sequences M5XES8
ppa009830m|PACid:17656970 XP_007218804.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]