SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007222927.1.23749 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007222927.1.23749
Domain Number 1 Region: 312-472
Classification Level Classification E-value
Superfamily eEF1-gamma domain 9.55e-62
Family eEF1-gamma domain 0.0000473
Further Details:      
 
Domain Number 2 Region: 123-264
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.21e-28
Family Glutathione S-transferase (GST), C-terminal domain 0.0067
Further Details:      
 
Domain Number 3 Region: 46-134
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.74e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007222927.1.23749
Sequence length 472
Comment elongation factor 1-gamma isoform X1 [Prunus persica]; AA=GCF_000346465.2; RF=representative genome; TAX=3760; STAX=3760; NAME=Prunus persica; cultivar=Lovell; AL=Chromosome; RT=Major
Sequence
MVIFSRNKNPSQHSLYCLLLSHSFASLVLSRKNAPPHRSQVRAKRFSAKAMALVLHAGKT
NKNAFKTLIVAEYTGVKVELAPDFEMGVTNKTPEYLKLNPIGKVPLLVTPDGPIFESNAI
ARYVARLKADNPLIGSSLIDYAHIEQWIDFGSLEIDANIISWFRPRFGSAVYLPPAEEAA
ISALKRALGALNTHLASNTYLVGHFVTLADIIVTCNLLIGFTKLMTKSFTSEFPHVERYF
WTLVNQPNFKKVLGDVKQTESVPPVPSAKKPSQPKETKSKAKEEPKKEAKKEPAKPKAEA
AEEVEEAPKPKPKNPLDLLPPSGMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLW
FCEYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEI
PPFVMEECYDMELYNWTKVDLSDENQKERVNQMIEDQEPFEGEVLLDAKCFK
Download sequence
Identical sequences M5XF89
ppa005220m|PACid:17662951 XP_007222927.1.23749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]