SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007238350.1.101067 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007238350.1.101067
Domain Number 1 Region: 40-284,318-560
Classification Level Classification E-value
Superfamily Sema domain 1.18e-86
Family Sema domain 0.0023
Further Details:      
 
Domain Number 2 Region: 1386-1509,1676-1828
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-34
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 888-981
Classification Level Classification E-value
Superfamily E set domains 3.95e-17
Family Other IPT/TIG domains 0.017
Further Details:      
 
Domain Number 4 Region: 978-1071
Classification Level Classification E-value
Superfamily E set domains 0.0000000000938
Family Other IPT/TIG domains 0.03
Further Details:      
 
Domain Number 5 Region: 1070-1152
Classification Level Classification E-value
Superfamily E set domains 0.000000000153
Family E-set domains of sugar-utilizing enzymes 0.039
Further Details:      
 
Domain Number 6 Region: 563-615
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000227
Family Plexin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007238350.1.101067
Sequence length 1900
Comment PREDICTED: plexin-D1 [Astyanax mexicanus]; AA=GCF_000372685.1; RF=representative genome; TAX=7994; STAX=7994; NAME=Astyanax mexicanus; AL=Scaffold; RT=Major
Sequence
MSRTATRVPRAAASPLLAAQLLLLIAASLTRAAGALRVHQAFSSPSETNNFAVDAESRRV
YVGAVNALYQLSGSLAPEAEQRTGPVQDSALCHAPQLPQAPCEHARALADNHNKLLALDG
AQGVLVACGSVHQGFCELRSLENVTRMAVSFPPPGAAVFPSMLNVAANHANASTAGLVFR
VRGGVGGGGSARLLVAATYTGAGSDFFPRNRSREDLRFENTPEIAIRALDAAEPTRLFTY
DINPSEDNVLKIKQEAKARNKLAFVRAFAWHTYAYVAMNRDGVGGAGGGGGGAGGSTGGG
ATSGGGGSGGGGGGGGAKESEPSSVLARICLDAEVPRRSAAAEPRKLTESYVQMGLQCGA
GGNVYGRLVSVFAAENVFTDSHERAEPYLFGVFSRAGSRWTALCAFRFADVEERIREARR
NCSSGPNGDVRVLDSVIQGSGAECEAKGNIVLQQEQLNCGAAHLQHPLALQKPLRATPLY
EAPGISSVAVDNIHNHTVVFLGSSNGWLRKLSLLRNFTVANQWPLRLAAGESVHHIMTFD
PNDRNYLYLMTTHHLFRVQVAACDQYSSCSDCLSASDAYCGWCTLESRCSIQEECSSRGV
ARSWISIREGPQQCPSMTFTPAQFSRTADITNVGILVDGSVPDLDGLGLECDYGVGMATV
ATVHLDEGSAKIQTCPLPPASRFPEIPLGEDHIVVPVAIRVNGTSVVSGSFIIYDCKRTG
EIHSKTACTSCLSTNWRCNWDQQLNLCFSDKHSAQGMVLENAADCPSVVAQEFPPRPTGS
AEDITLRLSNVEQDTELDCDFGNGQSYEAHWLDGQSAVKCSGVTVSTANHKPPVSLSLSL
SVVEVYSCSGGDSDCSQCWGREQQGHLCAWCENSCRPRDQCQPIRMQCPDPTIHKIHPLS
GPITGGTLLTVQGKNLGRRAEDVKVSIGDTSCLLLPERYTVSTELVCETGQSSQTLQSKV
EVRVSDNGMGHSRETFSYVEPTLLDLMPREGPIAGGTRLTIRGVSLEAGSSVKVKVNNTQ
DCKIDILSADIIQCVMPPAVPEHAEDVWLCVEYNGRPCERHLSRSFSYQNNPTISKIKPN
KSYLSGGRTISVIGQGFHLVQTAQLEMVGIGDKDCRVLSPTLLLCPSPPSIQSQQVSVQF
KLNGNLYRGESHASYGLDLEEEEEPHTGHFLFEYVEDPQFYTANKEKLIKHHPGEPLLLV
INKGPSQLDLTEEEYSVRIGSDICDITFNNEQMIYCTINRTLSSRTGELPVTVQVGNFHK
QIAVVQMGGSELAIIVTVAVCCVLLLLCTVVCVYVWFAGFAELQTDMTDLTKELNRSQGI
PFLEYKQFVTRTFFPKMCSDYERSLVQPVYENNPQGPRALPETHPLLQDWQPSNTARPNM
EEGITLFSTLLNNKHFLITFVHALEQQKDFAVRDRCNLASLLTIALHGKLEYYTSIMKEL
LVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQIN
KGSIDAITGKARYTLNEEWLLRENIEAKPLNINVSFQGFGMDSVSVRVMNTDTICQVKEK
ILEAFYKNLPFSQWPHEEDVDLEWFPGGGCSSRILQDLDNTSIMEDGRKKLNTVFHYKIP
EGASLAMSMKDKRENTLGRAKDLDTEKYVHLVPPHDELIEPKKSHRHSHRKKVLPEIYLT
RLLSTKGTLQKFLDDLFQAILSIPQEKPPLAVKYFFDFLEEQADKRGITDPDTLHIWKTN
SLPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYA
KEIPEYKKRVQCFYKQIQEMAPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKRYR
TQVVNALDSNPTARRTQLQHRFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences XP_007238350.1.101067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]