SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007243650.1.101067 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007243650.1.101067
Domain Number 1 Region: 44-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000214
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 2 Region: 85-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000878
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 3 Region: 7-52
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000134
Family EGF-type module 0.022
Further Details:      
 
Domain Number 4 Region: 120-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000274
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007243650.1.101067
Sequence length 175
Comment PREDICTED: neurogenic locus notch homolog protein 3-like, partial [Astyanax mexicanus]; AA=GCF_000372685.1; RF=representative genome; TAX=7994; STAX=7994; NAME=Astyanax mexicanus; AL=Scaffold; RT=Major
Sequence
MKCDREDSCVSSPCANGGICTALPAGKFSCTCPPGYQGDRCLNDTDECAVTPAVCQNGGQ
CVNVPGSYQCSCAPGFTGRNCESPYVPCSPSPCLNGGTCRQTSDTTYWCHCLPGFTGDNC
EVNIDDCPDHKCQNGATCMDGVNTYNCQCPPEWTGETQFVLCVKGQQIRLNIRSD
Download sequence
Identical sequences XP_007243650.1.101067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]