SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007253185.1.101067 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007253185.1.101067
Domain Number 1 Region: 321-399
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.92e-26
Family Intermediate filament protein, coiled coil region 0.0000394
Further Details:      
 
Domain Number 2 Region: 92-126
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000000164
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Domain Number 3 Region: 99-206
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000314
Family Myosin rod fragments 0.01
Further Details:      
 
Weak hits

Sequence:  XP_007253185.1.101067
Domain Number - Region: 230-302
Classification Level Classification E-value
Superfamily Apolipophorin-III 0.0196
Family Apolipophorin-III 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007253185.1.101067
Sequence length 476
Comment PREDICTED: alpha-internexin-like [Astyanax mexicanus]; AA=GCF_000372685.1; RF=representative genome; TAX=7994; STAX=7994; NAME=Astyanax mexicanus; AL=Scaffold; RT=Major
Sequence
MSYGSDAYSASSSYRKIFGDSPRYSSSPSRMSSSRTGGYRSLSMTRTGASSLGSYKRAGR
SALSSGPMSLGLDTLDFAQSSVLNNEFKIIRTNEKEQMQGLNDRFAMFIEKVRNLEQHNK
VLETELVTLRQRQSEPSRLAELYQQEIRELRSQLEEAHGEKNQMMFERDNVEEELQKLRE
RYEDEVRARDESERTLKAFRKDVDDASLARLDLEKKVESLLDEIAFLRRAHDEEVAELMN
AIQASQVSVEMEVAKPDLTSALKEIRGQYESLASKNLQSAEEWYKSKFADLSEQANRSNE
AIRASREEVNEFRRQLQSKTIEIESLRGTNESLERQLREMEDRHNMEVAGYQEAIGELEN
ELRTTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRISTGMPYPIPSSVSSSQ
SYSYQSRIYTSSGKTAKKEGKDEEDKQEQNAKSESNPSKKADKQESGDVNSTSQKN
Download sequence
Identical sequences W5LH40
XP_007253185.1.101067 ENSAMXP00000019152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]