SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007255351.1.101067 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007255351.1.101067
Domain Number 1 Region: 488-653
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 9.02e-73
Family A middle domain of Talin 1 0.0000000903
Further Details:      
 
Domain Number 2 Region: 752-888
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.37e-53
Family I/LWEQ domain 0.00000102
Further Details:      
 
Domain Number 3 Region: 659-782
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.44e-51
Family I/LWEQ domain 0.0000023
Further Details:      
 
Domain Number 4 Region: 2293-2482
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.57e-51
Family I/LWEQ domain 0.0001
Further Details:      
 
Domain Number 5 Region: 1842-1970
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 6.91e-41
Family VBS domain 0.00000337
Further Details:      
 
Domain Number 6 Region: 1223-1360
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.65e-38
Family VBS domain 0.022
Further Details:      
 
Domain Number 7 Region: 195-308
Classification Level Classification E-value
Superfamily Second domain of FERM 1.23e-35
Family Second domain of FERM 0.000000757
Further Details:      
 
Domain Number 8 Region: 309-399
Classification Level Classification E-value
Superfamily PH domain-like 6.39e-25
Family Third domain of FERM 0.00001
Further Details:      
 
Domain Number 9 Region: 1074-1206
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.98e-21
Family VBS domain 0.074
Further Details:      
 
Domain Number 10 Region: 1466-1554
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000432
Family I/LWEQ domain 0.0074
Further Details:      
 
Domain Number 11 Region: 2005-2129
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000659
Family VBS domain 0.021
Further Details:      
 
Domain Number 12 Region: 1686-1808
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000148
Family VBS domain 0.037
Further Details:      
 
Domain Number 13 Region: 920-982
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000765
Family I/LWEQ domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007255351.1.101067
Sequence length 2541
Comment PREDICTED: talin-1 isoform X1 [Astyanax mexicanus]; AA=GCF_000372685.1; RF=representative genome; TAX=7994; STAX=7994; NAME=Astyanax mexicanus; AL=Scaffold; RT=Major
Sequence
MVALSLKIGVGNVVKTMQFEPSTMVYDACRIIRERVPEAQLGQPNDYGLFLSDEDPKKGI
WLEAGKALDYYMLRNGDTLDYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIG
ITNYDEYSLVRDIGEEKKEETTGTLKRDKTLLRDDKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEETEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
YQCQIQFGDHNESKHKPGFLDLKEFLPKEYIKNKGEKKIFQAHKNCQNMTEIEAKVSYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVMQEWSLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVMQQQFNKVGKVETGSVAMPVIMRSGAGGQGSFQMGSMPQAKQQITSGQM
HTGHMPPLTSAQQALTGTINSSMQAVQAAQASLDDFDALPPLGTDAASQAWRKNKMDESK
HEIHSQVDAITAGTASMVNLTAGDPAETDYTAVGCAVTTISSNLTEMSKGVKLLAALMED
EGGTGQQLLGAARNLACAVSDMLKTAQPASTEPRQNLLQAAGNVGQASGELLQQIGESDA
DQQFQDMLMKLAKAVANAAAALVLKAKNVAQKTEDSAQQNRVIAAATQCALSTSQLVACT
RVVAPTISSPVCQEQLIEAGKLVAKSVEGCVEASQGATGDEHLLKQVGAAATGVTQALNE
LLQHIKQYASGGQPIGRHGEATDRILDVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGETDLENSRKLLSAAKLLADATARMVEAAKGAAANPDSEEQQQKLREAAEGLRMA
TNAAAQNAIKKRLVNKLENAAKQAAAAATQTIAAAQHAASSNKNPAAQQQLVQSCKVVAD
QIPQLVQGVRGSQAQPDSPSAQLALIGSSQNFLQPGAKMVTAAKATVPTISDQASAMQLS
QCAKNLASALAELRTAAQKAQEACGPLEIDNALTVVRGLERDIQEAKAAAAEGKLRPLPG
ETLEKCSQDLGSNTKAVSSAVAQLLSEAAQGNENYTGLAARDVAQALRSLAAAARGVAAT
TEDPQARNAMLDCTGDVMDKSANLIEETKRAVAKPGDPDCQQRLAQVAKALSQALNRSVN
CLPGQRDVDNAIRTVGEASKKLLSDQFPASGKSFQEAQAGLNQAAAGLNQSANELVQASR
GTTQDLAKASGKFGKDFSHFLEAGVDMAGQSQSKEDQTQVVTNLKTISMSSSKLLLAAKA
LSTDPNSPNLKNQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRGMLENPT
EAVNDLGYFDCIDSVMENSKVLGEAMAGISHNAKNSNLPEFGDAVSSASKALCGLTEAAT
QGAYLVGVSDPNSHAGQKGLVDPAQFAKAKQSIQMACQNLVDPACTQSQVLSAATIVAKH
TSALCNACRLASSKTSNPVAKRQFVQSAKEVANSTANLVKSIKALDGAFNQENRQKCKAA
TGPLIEAVDNLTAFASNPEFASVPAQISPEGLAAMEPIVAAAKTMLESSTGMIQTARSLA
VNPKDPPKWSVLAGHSRTVSDSIKKLITNMRDKAPGQRECDEAIEVLNNCIREVDQASLA
AISQQLTPRDDISHEALHEQMAASVQEISHLIDPVAIAARSDASQLGHKVSQMASYFEPL
IMAAIGTASKILNSQQQMSVLDQTKTLAESALQILYTAKEAGGNPKAAHTQEALEEAVQM
MKEAVDDLGGTLTEAAGAAGAVGGMVDTITQAINRMEDQAVEPEGSFVDYQTTMVKTAKA
IAVTVQEMVTKSNTNPDELGGLANQLTNEFGDLASEAKCAVITAENDEIGSHIKKQVTEL
GYSCTGLVTKAGALQCSPNDSITKKELIDSARKVSEKVSHVLAALQAGNRGTQACITAAS
AVAGIIADLDTTIMFATAGTLNRENAETFADHREHILKTAKVLVEDTKLLVSGAGASQEK
LAQAAQSSVNTITKLADVVKLGAASLGSEDPETQVVLINAVKDVAKALGDLIRATKAAAG
KPHDDPAMLQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATIEHIKQELAVFSSA
DPPPKTATPEEFIRMTKGITLATAKAVAAGNSCRQEDVIATANLSRRAIADMLHSCKQAA
YHPEVSNEVRTRALRFGKECAHGYLGLLEHVLVPIIQKPTHDLKQQLASFSKRVAGSVTE
LIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLNFE
EQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANAVDDGQWSQGLISAARMVAA
ATNNLCEAANSAVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSQTMKRLQAAGNA
VKKASDNLVKAAQKAAFEAQDDQAVMVKSKMVGGIAQIIAAQEEMLRKERELEEARRKLA
QIRQQQYKFLPSELREDGQEQ
Download sequence
Identical sequences XP_007255351.1.101067 XP_015462851.1.101067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]