SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007261098.1.101067 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007261098.1.101067
Domain Number 1 Region: 24-115
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-31
Family Ras-binding domain, RBD 0.00022
Further Details:      
 
Domain Number 2 Region: 336-446
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-31
Family SH2 domain 0.00000427
Further Details:      
 
Domain Number 3 Region: 146-259
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000017
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007261098.1.101067
Sequence length 449
Comment PREDICTED: growth factor receptor-bound protein 14 isoform X2 [Astyanax mexicanus]; AA=GCF_000372685.1; RF=representative genome; TAX=7994; STAX=7994; NAME=Astyanax mexicanus; AL=Scaffold; RT=Major
Sequence
MLCTQPYLSCRASPKSQLCLPPNTGVIKVYTEDNSSRAVEVPSDITARDICQLFVLKNHC
IDDHSWTLFEHLAHLGIERTIEDHESVLEVQSNWGMDSDSRLYFRKNYAKYEFFKKPLDF
FPENMVSISSEANGLMNHSELIQTFLNSSTCPEIHGFLHSKEQGRKSWKKFYFVLRRSGL
YFSNKGTSKEPRHLQFAAEFCDGDVYTLLSARKTHGAPTDYGFCVKPSKSSSARDLKLLC
ADDEQTRTCWITAMRLFKFGMQLYQNFIQPHQKQKNSPMRSISENSLVAMDFSGHRSRVI
ENPSEALSVAVEEGLSWRRKSCHRLSHGSCSPSQSSLSNIAIHMAQPWFHSKLSRDEAQK
LITQHGLIDGVFLLRDSQSNPKTFVLSLCHTQRIRHFQILPVEDDGELFYSLDDGNTRFT
DLLQLVEFYQLNRGVLPCKLKHHCARTTL
Download sequence
Identical sequences W5KM34
XP_007261098.1.101067 ENSAMXP00000008646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]