SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007267664.1.56834 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007267664.1.56834
Domain Number 1 Region: 101-197
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000246
Family Thioltransferase 0.055
Further Details:      
 
Domain Number 2 Region: 313-396,423-442
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000455
Family UBX domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007267664.1.56834
Sequence length 485
Comment hypothetical protein FOMMEDRAFT_157464 [Fomitiporia mediterranea MF3/22]; AA=GCF_000271605.1; RF=representative genome; TAX=694068; STAX=208960; NAME=Fomitiporia mediterranea MF3/22; strain=MF3/22; AL=Scaffold; RT=Major
Sequence
MLSIAKLLGSLVRILLYPLTTSLSTLQRLFIYFTTWLPSTSRRHVANDAASVADRWVREL
EEETGAIRESRLSDLNASSSASGADAQAGPGPSTLSRRNESARATRLQIPEFYLGSYENA
LREAQRDARLLCIVIVSEEHEDVPEFKRTTLVDPEFNKILRSNDFLVWGGDVRDYEASQA
SQKLGATTYPFVAFLANQPRGGSRGSTSSPVLTILSRHQGPSTPSDADLPTSDLGPTSPR
ALCIHLSNSLLPRVTPFLARLRAAHAERLAQRRLREEQDAAFARSAEADRARVLAKREEE
RRQQEEIEMQELIRVREEAERRKAQDEKEEREKNRLLWYRYARRSLLPPEAAPGKGSIRV
GVRFPDGRLQVRHFSPSDSVTSLYVFVASQLIPKEHAPAEDPTSPPTGFTPGEMGISGDS
WSFKLALSYPRREVPWVKSTPLSNIDGLKGGAQLVVESIPGHALIPGSNAQSQGDGDSDY
DTEEE
Download sequence
Identical sequences XP_007267664.1.56834 jgi|Fomme1|157464|gm1.7794_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]