SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007311173.1.56996 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007311173.1.56996
Domain Number 1 Region: 104-206
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000163
Family UAS domain 0.081
Further Details:      
 
Domain Number 2 Region: 305-387,423-439
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000289
Family UBX domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007311173.1.56996
Sequence length 484
Comment hypothetical protein STEHIDRAFT_69114 [Stereum hirsutum FP-91666 SS1]; AA=GCF_000264905.1; RF=representative genome; TAX=721885; STAX=40492; NAME=Stereum hirsutum FP-91666 SS1; strain=FP-91666 SS1; AL=Scaffold; RT=Major
Sequence
MLSILAFPFHVIASLIRYIFGRLHISLPTFPFSSLNFYRPIWPNSVGHASSSDPYSVADR
WVRALEDETGALCVSHARVGRASDSDAVEGVASSSNVGSLSNSTGLRTRYGTISAKVLPD
FTLGSYEDALQTCQREVRIGCIILVSDEHDDVLEFKRNTLTDPTFVDLLHTNNFVVWGGD
VRDKEGWAASQKLQATTYPFVAFVSLQPPRGFTSRQSSTSSNSTPSLTILSRHQGASATL
PHVLSTHISTQLLPRITPFLERIRNANRERDLERRLRAEQDAAFAESARRDREKIEMRVR
EEKAAEEAKRLEEEKAMQEEERKRQRAQVKRSWRKLRRGELIPAEAKELRMGIRLGDGER
LMRGFAKADSVTALHAFVDAHLVPAEEISEKDEVIFDQGEDDEYEIVRMIEDAGQSADEW
WGFKLFTAYPRREVAWTPGTKLAEIPGLEQGGQLVVEMVDVDRRRSSESQRVGDGDDSDG
YETE
Download sequence
Identical sequences R7RW90
jgi|Stehi1|69114|e_gw1.24.6.1 XP_007311173.1.56996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]