SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007362866.1.3125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007362866.1.3125
Domain Number 1 Region: 7-114
Classification Level Classification E-value
Superfamily Fungal immunomodulatory protein, FIP 1.31e-48
Family Fungal immunomodulatory protein, FIP 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007362866.1.3125
Sequence length 115
Comment immunomodulatory protein FIP-Fve [Dichomitus squalens LYAD-421 SS1]; AA=GCF_000275845.1; RF=representative genome; TAX=732165; STAX=114155; NAME=Dichomitus squalens LYAD-421 SS1; strain=LYAD-421 SS1; AL=Scaffold; RT=Major
Sequence
MSAHVNSTAITFALVWAEKKLTFDYTPNWVRGHPSSYVDNVVFPKVLTDKKYSYRVLVSG
KDLGVRDGYSVQSDGSQKVNFLEYNAGRGIADSNTIQVYAVDPDDGNNYLVAQCN
Download sequence
Identical sequences XP_007362866.1.3125 jgi|Dicsq1|125142|fgenesh1_pg.5_#_48

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]