SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007365665.1.3125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007365665.1.3125
Domain Number 1 Region: 419-500,537-548
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000372
Family UBX domain 0.048
Further Details:      
 
Domain Number 2 Region: 215-302
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000671
Family Thioltransferase 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007365665.1.3125
Sequence length 601
Comment hypothetical protein DICSQDRAFT_169986 [Dichomitus squalens LYAD-421 SS1]; AA=GCF_000275845.1; RF=representative genome; TAX=732165; STAX=114155; NAME=Dichomitus squalens LYAD-421 SS1; strain=LYAD-421 SS1; AL=Scaffold; RT=Major
Sequence
MDIDSLSPAQTNGGDAEVAISVLASVDWDVQRAAEVVFDGVPPPPSPPAHESTNHVEQFE
IDDSEQDGLLNGPQGRREFRPVESSFFGTIIIRPLRIVFNILAIPLYPLFSLLRFIFRAL
RIPLPSFGSYSFSYRPLGPGRSRESRDPKSVAEQWVRALEEETGAVCISRSGNRKQSQGN
GHGVASGVAGPSTLTARGSAWEEGSNGSAESDKLLPDFFLGGYEEFARTCQRDLKIGCVV
IVSSEHDNDAEFKRSTLTDPSFLRIIQENEILVWGGDIRDREAWSAAQKLQATTYPFIAF
IALQPRRAPGSSSAPAPTMTILSRHQGPSIPSTSAPTAAQTLVIHLNEQLLPRVTPFLNK
LRLEAAERERERALRAEQDRAFEESRRKDAERILQKRAADAAAQDEKRRAAEAQARAIEE
EHKAEEAKKQWVAHRMEWRRWLRRGLVLREPRPGESGRGKTMRVGVRMPDGRRSVRFFGE
SDPLTSLYAYVDSLLIPPEFVQDADPVAPPQGGKEGEEGIVGNMQRTGRSPEKWWGFKLV
LAYPRREVPWEAGKKIGDIDVLKGGGQVVVEFVTDEDAKSKGKSRSSLEQDDDDEYHTES
D
Download sequence
Identical sequences R7T0R7
jgi|Dicsq1|169986|gm1.5755_g XP_007365665.1.3125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]