SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007461666.1.90284 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007461666.1.90284
Domain Number 1 Region: 529-748
Classification Level Classification E-value
Superfamily Bet v1-like 5.15e-40
Family STAR domain 0.0055
Further Details:      
 
Domain Number 2 Region: 130-248
Classification Level Classification E-value
Superfamily PH domain-like 6.17e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007461666.1.90284
Sequence length 757
Comment PREDICTED: collagen type IV alpha-3-binding protein isoform X1 [Lipotes vexillifer]; AA=GCF_000442215.1; RF=representative genome; TAX=118797; STAX=118797; NAME=Lipotes vexillifer; AL=Scaffold; RT=Major
Sequence
MQHSGVPVPPSPFSVPPTFLPGVTREGRRGLSSGGSAGQSARVTATATTAAAADGWKGRL
PSPLVLLPRSARCQARRRRRRGGRTSSLLQLPSAPERALLPSPSSDASPRGLGASAGAAQ
GAGAGLLLGCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVL
KNNTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQ
WIDAIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETF
RDILCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKV
FPHVTPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKESEKRRRI
EEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRL
HWPTSMPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTY
SLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDV
RNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSAIRKIPALTENDPETWI
VCNFSVDHSSAPLNNRCVRAKINIAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGG
WAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences XP_007461666.1.90284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]