SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007475268.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_007475268.1.35504
Domain Number - Region: 3-132
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00818
Family DBL homology domain (DH-domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007475268.1.35504
Sequence length 168
Comment PREDICTED: uncharacterized protein C9orf9 homolog isoform X2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MNEVKELLRNIEQTYRLFQQQQFTFIAALEHCRENAHDKIRPITSIGQVQNYMEHYCNNS
TDHRILQMFLKICTELNRLCQQFENLHPGTPTTNNILEKCKILVSHSNDLSSLRARYPHD
VVNHLSCDEARNHYGGVVSLIPITVDLMKEWIAHSEKLPRKAAQHGAT
Download sequence
Identical sequences F6PLC3
ENSMODP00000015723 XP_007475268.1.35504 ENSMODP00000015723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]