SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007477764.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007477764.1.35504
Domain Number 1 Region: 553-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.99e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 329-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.13e-25
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 10-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.41e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 4 Region: 245-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.94e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 497-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 189-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 7 Region: 385-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.35e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 8 Region: 595-647
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.64e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 9 Region: 442-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.77e-19
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 10 Region: 133-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000131
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 11 Region: 95-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000785
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 12 Region: 292-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000136
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007477764.1.35504
Sequence length 665
Comment PREDICTED: zinc finger protein 585B-like isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MAPVLLTARPCRESVTFKDVAVEFTWEEWIYLNPSQKKLYKDVMLENYRNLISLGFALSK
PDVIYHLERKEASWMPEADVPRSSCSESKEFTKDKPYECIECGNAFRIKKQLIMHQRSHT
RKIFYKCKEFGKTFFCNTEFIQHQRIHTEEKHFECSECGKVFRRKSEFTIHQRMHTEEKP
HRYSEDIEAFKSKTLLAVHQGTHKGEKPYECSECGKTFRRKQELIVHHRVHTGERPYECS
ECKKAFRRKSELTVHQKIHTGEKPYKCSECVEAFRRKTLLTVHQRIHTGERPYKCSVCGK
AFRIKAELTMHQIIHTGKVLYECKECGKAFHYNSDLIRHQRIHTGEKPYECSVCRKAFSM
KTNLKVHQRIHTAEKPYECSECGKSFRQKTQLYVHQRIHTGKILYKCKECGKAFLYNSEL
VKHQRIHIREKPYECRECGKPFCMKSDLNVHQKVHSRGKPYECSHCGKTFVIKTQFIMHQ
RIHTGKTLYECKECGKSFLYNSELIQHQRLHTGEKPYECSICGKAFSMKSNLTAHQRIHN
GEILFECKDCGKSFLYNSELIRHQRIHTGEKPYKCSECGKAFSMKTNLTVHQRIHTGERP
YECSKCGKAFSLKKHLLVHQRIHTGEKPYECSECGKAFRQKTQLYVHQRIHTAVTLKNSK
RLGSS
Download sequence
Identical sequences XP_007477762.1.35504 XP_007477763.1.35504 XP_007477764.1.35504 XP_007477765.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]